PGP9.5 antibody Western blot. All lanes: Anti PGP9.5 at 0.5 ug/ml. Lane 1: Rat Brain Tissue Lysate at 50 ug. Lane 2: Mouse Brain Tissue Lysate at 50 ug. Lane 3: U87 Whole Cell Lysate at 40 ug. Predicted band size: 25 kD. Observed band size: 25 kD.
UCHL1 / PGP9.5 Antibody (aa120-153)
Primary AntibodyLSBio Guarantee
| Antibody: | Rabbit Polyclonal |
| Applications: | Immunohistochemistry (general), Immunohistochemistry, Paraffin, Western Blot |
| Reactivity: | Guinea Pig, Human, Mouse, Rabbit, Rat |
| Format: | Lyophilized |
$480.00each
Catalog Number: LS-C408051-100
Catalog Number: LS-C408051
For bulk orders or custom formulations:
Request a QuoteOverview
- Description
- PGP9.5 antibody LS-C408051 is an unconjugated rabbit polyclonal antibody to PGP9.5 (UCHL1) (aa120-153) from human. It is reactive with human, mouse, rat and other species. Validated for IHC and WB.
- Application
- IHC, IHC-P, WB
- Reactivity
- GP, Hu, Ms, Rb, Rt
- Intended Use
- RUO
- Guarantees
- This antibody carries the LSBio 100% Guarantee. ✓
- Category
- Antibodies > Primary Antibodies > Polyclonal Antibodies
- Alternative Names
- Ubiquitin C-terminal hydrolase | PARK5 | PGP9.5 | PGP95 | Ubiquitin thioesterase L1 | Neuron cytoplasmic protein 9.5 | PGP 9.5 | Uch-L1 | UCHL1 | Ubiquitin carboxyl-terminal esterase L1 | HEL-117 | NDGOA | HEL-S-53 | SPG79
- UniProt Number
- P09936
- NCBI GenBank
- NM_004181, NP_004172.2
- SwissProt
- P09936
Target
- Target
- Human UCHL1 / PGP9.5
- Antigen Species
- Hu
- Epitope
- Found in neuronal cell bodies and processes throughout the neocortex (at protein level). Expressed in neurons and cells of the diffuse neuroendocrine system and their tumors. Weakly expressed in ovary. Down-regulated in brains from Parkinson disease and Alzheimer disease patients. .
- Gene Name
- UCHL1
Antibody
- Host Species
- Rb
- Clonality
- Polyclonal
Immunogen
- Immunogen
- A synthetic peptide corresponding to a sequence at the C-Terminus of human PGP9.5 (120-153 aa ETEKMSPEDRAKCFEKNEAIQAAHDAVAQEGQCR), different from the related mouse and rat sequences by two amino acids.
- Immunogen Type
- SP-Lin
Format
- Conjugate/Label
- Unconj
- Format
- Lyophilized
- Formulation
- Lyophilized from 0.2mg Na2HPO4, 5mg BSA, 0.9mg NaCl, 0.05mg sodium azide.
- Preservative
- Yes
- Purification Method
- AP
Storage & Handling
- Storage Conditions
- At -20°C for 1 year. After reconstitution, at 4°C for 1 month. It can also be aliquotted and stored frozen at -20°C for a longer time. Avoid freeze-thaw cycles.
- Recommended Storage Buffer
- NaCl