Polyclonal Rabbit anti-Human SLC5A11 / SMIT2 Antibody (WB)
Catalog Number: LS-C748223
2 sizes / from $281.00
Antibody: Rabbit Polyclonal
Applications: Immunohistochemistry (general), Western Blot
Reactivity: Human, Mouse, Rat
Format: Liquid
UBE1C antibody Western blot. All lanes: Anti UBE1C at 0.5 ug/ml. Lane 1: Rat Brain Tissue Lysate at 50 ug. Lane 2: HELA Whole Cell Lysate at 40 ug. Predicted band size: 52 kD. Observed band size: 52 kD.
Polyclonal Rabbit anti-Human UBA3 / UBE1C Antibody (aa409-448, IHC, WB)
Primary AntibodyLSBio Guarantee
| Antibody: | Rabbit Polyclonal |
| Applications: | Immunohistochemistry (general), Immunohistochemistry, Paraffin, Western Blot |
| Reactivity: | Hamster, Horse, Human, Mammal (Other), Mouse, Rat, Sheep |
| Format: | Lyophilized |
$480.00each
Catalog Number: LS-C408050-100
Catalog Number: LS-C408050
For bulk orders or custom formulations:
Request a QuoteOverview
- Description
- UBE1C antibody LS-C408050 is an unconjugated rabbit polyclonal antibody to UBE1C (UBA3) (aa409-448) from human. It is reactive with human, mouse, rat and other species. Validated for IHC and WB.
- Application
- IHC, IHC-P, WB
- Reactivity
- Ham, Hr, Hu, Mml, Ms, Rt, Sh
- Intended Use
- RUO
- Guarantees
- This antibody carries the LSBio 100% Guarantee. ✓
- Category
- Antibodies > Primary Antibodies > Polyclonal Antibodies
- Alternative Names
- HUBA3 | UBE1C | Ubiquitin-activating enzyme 3 | NEDD8-activating enzyme E1C | Nedd8-activating enzyme hUba3 | UBA3
- UniProt Number
- Q8TBC4
- NCBI GenBank
- NM_003968, NP_003959.3
- SwissProt
- Q8TBC4
Target
- Target
- Human UBA3 / UBE1C
- Antigen Species
- Hu
- Epitope
- Ubiquitously expressed.
- Gene Name
- UBA3
Antibody
- Host Species
- Rb
- Clonality
- Polyclonal
Immunogen
- Immunogen
- A synthetic peptide corresponding to a sequence at the C-Terminus of human UBE1C (409-448 aa KNRTLYLQSVTSIEERTRPNLSKTLKELGLVDGQELAVAD), identical to the related mouse and rat sequences.
- Immunogen Type
- SP-Lin
Format
- Conjugate/Label
- Unconj
- Format
- Lyophilized
- Formulation
- Lyophilized from 0.2mg Na2HPO4, 5mg BSA, 0.9mg NaCl, 0.05mg sodium azide.
- Preservative
- Yes
- Purification Method
- AP
Storage & Handling
- Storage Conditions
- At -20°C for 1 year. After reconstitution, at 4°C for 1 month. It can also be aliquotted and stored frozen at -20°C for a longer time. Avoid freeze-thaw cycles.
- Recommended Storage Buffer
- NaCl
