Polyclonal Rabbit anti-Human SLC5A11 / SMIT2 Antibody (WB)
Catalog Number: LS-C748223
2 sizes / from $281.00
Antibody: Rabbit Polyclonal
Applications: Immunohistochemistry (general), Western Blot
Reactivity: Human, Mouse, Rat
Format: Liquid
TSG101 antibody Western blot. All lanes: Anti TSG101 at 0.5 ug/ml. Lane 1: Rat Cardiac Muscle Tissue Lysate at 50 ug. Lane 2: Rat Brain Tissue Lysate at 50 ug. Lane 3: HELA Whole Cell Lysate at 40 ug. Lane 4: SMMC Whole Cell Lysate at 40 ug. Predicted band size: 44 kD. Observed band size: 44 kD.
Polyclonal Rabbit anti-Human TSG101 Antibody (aa361-390, WB)
Primary AntibodyLSBio Guarantee
| Antibody: | Rabbit Polyclonal |
| Applications: | Western Blot |
| Reactivity: | Bovine, Chicken, Dog, Goat, Guinea Pig, Hamster, Horse, Human, Mammal (Other), Mouse, Pig, Rabbit, Rat, Sheep, Xenopus, Zebrafish |
| Format: | Lyophilized |
$480.00each
Catalog Number: LS-C408134-100
Catalog Number: LS-C408134
For bulk orders or custom formulations:
Request a QuoteOverview
- Description
- TSG101 antibody LS-C408134 is an unconjugated rabbit polyclonal antibody to TSG101 (aa361-390) from human. It is reactive with human, mouse, rat and other species. Validated for WB.
- Application
- WB
- Reactivity
- Bov, Can, Ck, GP, Gt, Ham, Hr, Hu, Mml, Ms, Por, Rb, Rt, Sh, Xen, Zf
- Intended Use
- RUO
- Guarantees
- This antibody carries the LSBio 100% Guarantee. ✓
- Category
- Antibodies > Primary Antibodies > Polyclonal Antibodies
- Alternative Names
- ESCRT-I complex subunit TSG101 | Tumor susceptibility gene 10 | TSG101 | Tumor susceptibility protein | VPS23 | Tumor susceptibility gene 101 | TSG10
- UniProt Number
- Q99816
- NCBI GenBank
- NM_006292, NP_006283.1
- SwissProt
- Q99816
Target
- Target
- Human TSG101
- Antigen Species
- Hu
- Epitope
- Heart, brain, placenta, lung, liver, skeletal, kidney and pancreas.
- Gene Name
- TSG101
Antibody
- Host Species
- Rb
- Clonality
- Polyclonal
Immunogen
- Immunogen
- A synthetic peptide corresponding to a sequence at the C-Terminus of human TSG101 (361-390 aa KHVRLLSRKQFQLRALMQKARKTAGLSDLY), identical to the related mouse and rat sequences.
- Immunogen Type
- SP-Lin
Format
- Conjugate/Label
- Unconj
- Format
- Lyophilized
- Formulation
- Lyophilized from 0.2mg Na2HPO4, 5mg BSA, 0.9mg NaCl, 0.05mg sodium azide.
- Preservative
- Yes
- Purification Method
- AP
Storage & Handling
- Storage Conditions
- At -20°C for 1 year. After reconstitution, at 4°C for 1 month. It can also be aliquotted and stored frozen at -20°C for a longer time. Avoid freeze-thaw cycles.
- Recommended Storage Buffer
- NaCl
