Human Apolipoprotein H Antibody (IgA) ELISA Kit (Sandwich ELISA)
Catalog Number: LS-F67373-1
1 plate / $591.00
Reactivity: Human
Detection Method Colorimetric
Format: 96-Well Strip Plate
Western blot analysis of extracts of MCF7 cells.
TMEM189 Antibody
Primary AntibodyLSBio Guarantee
| Antibody: | Rabbit Polyclonal |
| Applications: | Immunohistochemistry (general), Western Blot |
| Reactivity: | Human |
| Format: | Liquid |
$281.00each
Catalog Number: LS-C409916-20
Catalog Number: LS-C409916
For bulk orders or custom formulations:
Request a QuoteOverview
- Description
- TMEM189 antibody LS-C409916 is an unconjugated rabbit polyclonal antibody to human TMEM189. Validated for IHC and WB.
- Application
- IHC, WB
- Reactivity
- Hu
- Intended Use
- RUO
- Guarantees
- This antibody carries the LSBio 100% Guarantee. ✓
- Category
- Antibodies > Primary Antibodies > Polyclonal Antibodies
- Recommended Dilution: IHC
- 1:50 - 1:100
- Recommended Dilution: WB
- 1:500 - 1:2000
- NCBI GenBank
- NM_199129, NP_954580.1
Target
- Target
- Human TMEM189
- Antigen Species
- Hu
- Epitope
- Human TMEM189
Antibody
- Host Species
- Rb
- Clonality
- Polyclonal
- Isotype
- IgG
Immunogen
- Immunogen
- A synthetic peptide corresponding to a sequence within amino acids 200 to the C-Terminus of human TMEM189 (NP_954580.1). TLLQDWHVILPRKHHRIHHVSPHETYFCITTGWLNYPLEKIGFWRRLEDLIQGLTGEKPRADDMKWAQKIK
- Immunogen Type
- SP-Lin
Format
- Conjugate/Label
- Unconj
- Format
- Liquid
- Formulation
- PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
- Volume
- 20 Microliter
- Preservative
- Yes
- Purification Method
- AP
Storage & Handling
- Storage Conditions
- Store at -20°C. Avoid freeze-thaw cycles.
- Recommended Storage Buffer
- PBS
