Polyclonal Goat anti-Goat Biotin Antibody (FITC, IF)
Catalog Number: LS-C758060-1
1 mg / $322.00
Antibody: Goat Polyclonal
Applications: Enzyme-Linked Immunosorbent Assay, Flow Cytometry, Immunofluorescence
Reactivity: Goat
Format: Liquid
Polyclonal Goat anti-Human TLR8 Antibody (aa81-109, WB)
Primary AntibodyLSBio Guarantee
| Antibody: | Goat Polyclonal |
| Applications: | Immunocytochemistry, Western Blot |
| Reactivity: | Human |
| Format: | Liquid |
$568.00each
Catalog Number: LS-C83989-200
Catalog Number: LS-C83989
For bulk orders or custom formulations:
Request a QuoteOverview
- Description
- TLR8 antibody LS-C83989 is an unconjugated goat polyclonal antibody to human TLR8 (aa81-109). Validated for ICC and WB.
- Application
- ICC, WB
- Reactivity
- Hu
- Predicted Reactivity
- NHP
- Intended Use
- RUO
- Guarantees
- This antibody carries the LSBio 100% Guarantee. ✓
- Category
- Antibodies > Primary Antibodies > Polyclonal Antibodies
- Alternative Names
- CD288 | TLR8 | Toll-like receptor 8 | CD288 antigen
- Recommended Dilution: IF/ICC
- 1:200
- UniProt Number
- Q9NR97
- NCBI GenBank
- NM_138636, NP_619542.1
- SwissProt
- Q9NR97
Target
- Target
- Human TLR8
- Antigen Species
- Hu
- Epitope
- Peptide sequence is <50 % identical to other human TLR receptors in this region. The antibody recognizes human TLR8 and mouse TLR8.
- Gene Name
- TLR8
Antibody
- Host Species
- Gt
- Clonality
- Polyclonal
- Origin Species
- Hu
Immunogen
- Immunogen
- 30 AA (aa)synthetic peptide C-ESFQGLQNLTKINLNHNPNVQHQNGNPGI corresponding to aa 81-109 of the N-Terminus domain of Human TLR8. Percent identity by BLAST analysis: Human, Chimpanzee, Gorilla, Orangutan, Gibbon (100%); Monkey (93%); Marmoset (86%).
- Immunogen Type
- SP-Lin
Format
- Conjugate/Label
- Unconj
- Format
- Liquid
- Formulation
- PBS, 1 mg/ml BSA, 0.1% Sodium Azide
- Preservative
- Yes
- Purification Method
- AP
Storage & Handling
- Storage Conditions
- Store at -20°C. Aliquot to avoid freeze/thaw cycles.
- Recommended Storage Buffer
- PBS
