Polyclonal Rabbit anti-Human SLC5A11 / SMIT2 Antibody (WB)
Catalog Number: LS-C748223
2 sizes / from $281.00
Antibody: Rabbit Polyclonal
Applications: Immunohistochemistry (general), Western Blot
Reactivity: Human, Mouse, Rat
Format: Liquid
Western blot analysis of extracts of HeLa cells, using STX10 antibody at 1:3000 dilution. The secondary antibody used was an HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates were loaded 25ug per lane and 3% nonfat dry milk in TBST was used for blocking. An ECL Kit was used for detection and the exposure time was 90s.
Polyclonal Rabbit anti-Human STX10 / Syntaxin 10 Antibody (WB)
Primary AntibodyLSBio Guarantee
| Antibody: | Rabbit Polyclonal |
| Applications: | Western Blot |
| Reactivity: | Human |
| Format: | Liquid |
$281.00each
Catalog Number: LS-C748850-20
Catalog Number: LS-C748850
For bulk orders or custom formulations:
Request a QuoteOverview
- Description
- Syntaxin 10 antibody LS-C748850 is an unconjugated rabbit polyclonal antibody to human Syntaxin 10 (STX10). Validated for WB.
- Application
- WB
- Reactivity
- Hu
- Intended Use
- RUO
- Guarantees
- This antibody carries the LSBio 100% Guarantee. ✓
- Category
- Antibodies > Primary Antibodies > Polyclonal Antibodies
- Alternative Names
- Hsyn10 | SYN10 | STX10 | Syntaxin 10 | Syntaxin-10
- Recommended Dilution: WB
- 1:500 - 1:2000
- UniProt Number
- O60499
- NCBI GenBank
- NM_003765, NP_003756.1
- SwissProt
- O60499
Target
- Target
- Human STX10 / Syntaxin 10
- Antigen Species
- Hu
- Gene Name
- STX10
Antibody
- Host Species
- Rb
- Clonality
- Polyclonal
- Isotype
- IgG
- Origin Species
- Hu
Immunogen
- Immunogen
- Recombinant fusion protein containing a sequence corresponding to amino acids 76-165 of human STX10 (NP_001258540.1). GKPAAQKSPSDLLDASAVSATSRYIEEQQATQQLIMDEQDQQLEMVSGSIQVLKHMSGRVGEELDEQGIMLDAFAQEMDHTQSRMDGVLR
- Immunogen Type
- Fusion-P
Format
- Conjugate/Label
- Unconj
- Format
- Liquid
- Formulation
- PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
- Volume
- 20 Microliter
- Preservative
- Yes
- Purification Method
- AP
Storage & Handling
- Storage Conditions
- Store at -20°C. Avoid freeze-thaw cycles.
- Recommended Storage Buffer
- PBS
