Stathmin 1 antibody Western blot. All lanes: Anti Stathmin 1 at 0.5 ug/ml. Lane 1: Mouse Brain Tissue Lysate at 50 ug. Lane 2: Mouse Testis Tissue Lysate at 50 ug. Lane 3: MM231 Whole Cell Lysate at 40 ug. Lane 4: MCF-7 Whole Cell Lysate at 40 ug. Predicted band size: 17 kD. Observed band size: 17 kD.
STMN1 / Stathmin / LAG Antibody (aa2-34)
Primary AntibodyLSBio Guarantee
| Antibody: | Rabbit Polyclonal |
| Applications: | Immunohistochemistry (general), Immunohistochemistry, Paraffin, Western Blot |
| Reactivity: | Bovine, Dog, Horse, Human, Mammal (Other), Mouse, Pig, Rat, Sheep |
| Format: | Lyophilized |
$480.00each
Catalog Number: LS-C407775-100
Catalog Number: LS-C407775
For bulk orders or custom formulations:
Request a QuoteOverview
- Description
- LAG antibody LS-C407775 is an unconjugated rabbit polyclonal antibody to LAG (STMN1 / Stathmin) (aa2-34) from human. It is reactive with human, mouse, rat and other species. Validated for IHC and WB.
- Application
- IHC, IHC-P, WB
- Reactivity
- Bov, Can, Hr, Hu, Mml, Ms, Por, Rt, Sh
- Intended Use
- RUO
- Guarantees
- This antibody carries the LSBio 100% Guarantee. ✓
- Category
- Antibodies > Primary Antibodies > Polyclonal Antibodies
- Alternative Names
- C1orf215 | Lag | LAP18 | OP18 | Phosphoprotein p19 | Phosphoprotein 19 | PP17 | PP19 | PR22 | Protein Pr22 | Transmembrane protein C1orf215 | Oncoprotein 18 | Prosolin | SMN | Metablastin | Stathmin | Stathmin 1 | STMN1
- UniProt Number
- P16949
- NCBI GenBank
- NM_005563, NP_005554.1
- SwissProt
- P16949
Target
- Target
- Human STMN1 / Stathmin / LAG
- Antigen Species
- Hu
- Epitope
- Ubiquitous. Expression is strongest in fetal and adult brain, spinal cord, and cerebellum, followed by thymus, bone marrow, testis, and fetal liver. Expression is intermediate in colon, ovary, placenta, uterus, and trachea, and is readily detected at substantially lower levels in all other tissues examined. Lowest expression is found in adult liver. Present in much greater abundance in cells from patients with acute leukemia of different subtypes than in normal peripheral blood lymphocytes, non-leukemic proliferating lymphoid cells, bone marrow cells, or cells from patients with chronic lymphoid or myeloid leukemia. .
- Gene Name
- STMN1
Antibody
- Host Species
- Rb
- Clonality
- Polyclonal
Immunogen
- Immunogen
- A synthetic peptide corresponding to a sequence at the N-Terminus of human Stathmin 1 (2-34 aa ASSDIQVKELEKRASGQAFELILSPRSKESVPE), different from the related mouse sequence by one amino acid, and identical to the related rat sequence.
- Immunogen Type
- SP-Lin
Format
- Conjugate/Label
- Unconj
- Format
- Lyophilized
- Formulation
- Lyophilized from 0.2mg Na2HPO4, 5mg BSA, 0.9mg NaCl, 0.05mg sodium azide.
- Preservative
- Yes
- Purification Method
- AP
Storage & Handling
- Storage Conditions
- At -20°C for 1 year. After reconstitution, at 4°C for 1 month. It can also be aliquotted and stored frozen at -20°C for a longer time. Avoid freeze-thaw cycles.
- Recommended Storage Buffer
- NaCl