SOD2 antibody Western blot. All lanes: Anti SOD2 at 0.5 ug/ml. Lane 1: Mouse Testis Tissue Lysate at 50 ug. Lane 2: Mouse Lung Tissue Lysate at 50 ug. Lane 3: Mouse Cardiac Muscle Tissue Lysate at 50 ug. Lane 4: Mouse Liver Tissue Lysate at 50 ug. Lane 5: HEPG2 Whole Cell Lysate at 40 ug. Predicted band size: 25 kD. Observed band size: 25 kD.
SOD2 / Mn SOD Antibody (aa192-222)
Primary AntibodyLSBio Guarantee
| Antibody: | Rabbit Polyclonal |
| Applications: | Immunohistochemistry (general), Immunohistochemistry, Paraffin, Western Blot |
| Reactivity: | Dog, Human, Mouse |
| Format: | Lyophilized |
$480.00each
Catalog Number: LS-C407655-100
Catalog Number: LS-C407655
For bulk orders or custom formulations:
Request a QuoteOverview
- Description
- Mn SOD antibody LS-C407655 is an unconjugated rabbit polyclonal antibody to Mn SOD (SOD2) (aa192-222) from human. It is reactive with human, mouse and dog. Validated for IHC and WB.
- Application
- IHC, IHC-P, WB
- Reactivity
- Can, Hu, Ms
- Intended Use
- RUO
- Guarantees
- This antibody carries the LSBio 100% Guarantee. ✓
- Category
- Antibodies > Primary Antibodies > Polyclonal Antibodies
- Alternative Names
- IPOB | MVCD6 | Indophenoloxidase B | SOD2 | Mn superoxide dismutase | MNSOD | Mangano-superoxide dismutase
- UniProt Number
- P04179
- NCBI GenBank
- NM_000636, NP_000627.2
- SwissProt
- P04179
Target
- Target
- Human SOD2 / Mn SOD
- Antigen Species
- Hu
- Gene Name
- SOD2
Antibody
- Host Species
- Rb
- Clonality
- Polyclonal
Immunogen
- Immunogen
- A synthetic peptide corresponding to a sequence at the C-Terminus of human SOD2 (192-222 aa QYKNVRPDYLKAIWNVINWENVTERYMACKK), different from the related mouse sequence by one amino acid, and from the related rat sequence by four amino acids.
- Immunogen Type
- SP-Lin
Format
- Conjugate/Label
- Unconj
- Format
- Lyophilized
- Formulation
- Lyophilized from 0.2mg Na2HPO4, 5mg BSA, 0.9mg NaCl, 0.05mg sodium azide.
- Preservative
- Yes
- Purification Method
- AP
Storage & Handling
- Storage Conditions
- At -20°C for 1 year. After reconstitution, at 4°C for 1 month. It can also be aliquotted and stored frozen at -20°C for a longer time. Avoid freeze-thaw cycles.
- Recommended Storage Buffer
- NaCl