Western blot analysis of extracts of various cells.

SLC22A11 Antibody

Antibody:	Rabbit Polyclonal
Applications:	Immunofluorescence, Immunohistochemistry (general), Western Blot
Reactivity:	Human, Mouse, Rat
Format:	Liquid

$281.00each

Catalog Number: LS-C409365-20

Unit Size

Quantity

For bulk orders or custom formulations:

Description: SLC22A11 antibody LS-C409365 is an unconjugated rabbit polyclonal antibody to SLC22A11 from human. It is reactive with human, mouse and rat. Validated for IF, IHC and WB.
Application: IF, IHC, WB
Reactivity: Hu, Ms, Rt
Intended Use: Research Use Only
Guarantees: This antibody carries the LSBio 100% Guarantee. ✓
Category: Antibodies > Primary Antibodies > Polyclonal Antibodies
Alternative Names: HOAT4 | Organic anion transporter 4 | SLC22A11
Recommended Dilution: IF/ICC: 1:50 - 1:100
Recommended Dilution: IHC: 1:50 - 1:200
Recommended Dilution: WB: 1:500 - 1:2000
UniProt Number: Q9NSA0
NCBI GenBank: NM_018484 | NP_060954.1
SwissProt: Q9NSA0

Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 40-150 of human SLC22A11 (NP_060954.1). FSAAIPGHRCWTHMLDNGSAVSTNMTPKALLTISIPPGPNQGPHQCRRFRQPQWQLLDPNATATSWSEADTEPCVDGWVYDRSVFTSTIVAKWDLVCSSQGLKPLSQSIFM
Immunogen Type: Fusion Protein (e.g., GST, MBP tag)