Polyclonal Rabbit anti-Human SLC5A11 / SMIT2 Antibody (WB)
Catalog Number: LS-C748223
2 sizes / from $281.00
Antibody: Rabbit Polyclonal
Applications: Immunohistochemistry (general), Western Blot
Reactivity: Human, Mouse, Rat
Format: Liquid
SFTP A1/2 antibody Western blot. All lanes: Anti SFTP at 0.5 ug/ml. Lane 1: Rat Lung Tissue Lysate at 50 ug. Lane 2: Mouse Lung Tissue Lysate at 50 ug. Lane 3: A549 Whole Cell Lysate at 40 ug. Predicted band size: 26 kD. Observed band size: 26 kD.
Polyclonal Rabbit anti-Human SFTPA1 + SFTPA2 Antibody (aa206-237, IHC, WB)
Primary AntibodyLSBio Guarantee
| Antibody: | Rabbit Polyclonal |
| Applications: | Immunohistochemistry (general), Immunohistochemistry, Paraffin, Western Blot |
| Reactivity: | Human, Mouse, Non-Human Primate, Rat |
| Format: | Lyophilized |
$480.00each
Catalog Number: LS-C357574-100
Catalog Number: LS-C357574
For bulk orders or custom formulations:
Request a QuoteOverview
- Description
- SFTPA1 + SFTPA2 antibody LS-C357574 is an unconjugated rabbit polyclonal antibody to SFTPA1 + SFTPA2 (aa206-237) from human. It is reactive with human, mouse, rat and other species. Validated for IHC and WB. Cited in 1 publication.
- Application
- IHC, IHC-P, WB
- Reactivity
- Hu, Ms, NHP, Rt
- Intended Use
- RUO
- Guarantees
- This antibody carries the LSBio 100% Guarantee. ✓
- Category
- Antibodies > Primary Antibodies > Polyclonal Antibodies
Target
- Target
- Human SFTPA1 + SFTPA2
- Antigen Species
- Hu
Antibody
- Host Species
- Rb
- Clonality
- Polyclonal
Immunogen
- Immunogen
- A synthetic peptide corresponding to a sequence at the C-Terminus of human SFTPA1/2(206-237 aa VNYTNWYRGEPAGRGKEQCVEMYTDGQWNDRN), different from the related mouse sequence by four amino acids, and from the related rat sequence by five amino acids.
- Immunogen Type
- SP-Lin
Format
- Conjugate/Label
- Unconj
- Format
- Lyophilized
- Formulation
- Lyophilized from 0.2mg Na2HPO4, 5mg BSA, 0.9mg NaCl, 0.05mg sodium azide.
- Concentration
- 0.5 mg/mL
- Preservative
- Yes
- Purification Method
- AP
Storage & Handling
- Storage Conditions
- At -20°C for 1 year. After reconstitution, at 4°C for 1 month. It can also be aliquotted and stored frozen at -20°C for a longer time. Avoid freeze-thaw cycles.
- Recommended Storage Buffer
- NaCl
Functional roles of C/EBPα and SUMO‑modification in lung development. Chen YD, Liu JY, Lu YM, Zhu HT, Tang W, Wang QX, Lu HY. International journal of molecular medicine. 2017;40:1037-1046. PubMed: 28902364 PMC: PMC5593452
