PRLR antibody Western blot. All lanes: Anti PRLR at 0.5 ug/ml. Lane 1: HELA Whole Cell Lysate at 40 ug. Lane 2: SGC Whole Cell Lysate at 40 ug. Lane 3: SW620 Whole Cell Lysate at 40 ug. Predicted band size: 90 kD. Observed band size: 90 kD.

PRLR / Prolactin Receptor Antibody (aa565-605)

Primary AntibodyLSBio Guarantee

Antibody:	Rabbit Polyclonal
Applications:	Western Blot
Reactivity:	Human
Format:	Lyophilized

See all Human PRLR / Prolactin Receptor antibodies →

$480.00each

Catalog Number: LS-C407994-100

Unit Size

Quantity

For bulk orders or custom formulations:

Overview

Description: Prolactin Receptor antibody LS-C407994 is an unconjugated rabbit polyclonal antibody to human Prolactin Receptor (PRLR) (aa565-605). Validated for WB.
Application: WB
Reactivity: Hu
Intended Use: RUO
Guarantees: This antibody carries the LSBio 100% Guarantee. ✓
Category: Antibodies > Primary Antibodies > Polyclonal Antibodies
Alternative Names: HPRL receptor | PRL-R | PRLR | HPRLrI | Prolactin receptor
UniProt Number: P16471
NCBI GenBank: NM_000949, NP_000940.1
SwissProt: P16471

Target

Target: Human PRLR / Prolactin Receptor
Antigen Species: Hu
Epitope: Expressed in breast, placenta, kidney, liver and pancreas. .
Gene Name: PRLR

Antibody

Host Species: Rb
Clonality: Polyclonal

Immunogen

Immunogen: A synthetic peptide corresponding to a sequence at the C-Terminus of human PRLR (565-605 aa HAKNVACFEESAKEAPPSLEQNQAEKALANFTATSSKCRLQ), different from the related mouse sequence by eleven amino acids, and from the related rat sequence by fourteen amino aci
Immunogen Type: SP-Lin

Format

Conjugate/Label: Unconj
Format: Lyophilized
Formulation: Lyophilized from 0.2mg Na2HPO4, 5mg BSA, 0.9mg NaCl, 0.05mg sodium azide.
Preservative: Yes
Purification Method: AP

Storage & Handling

Storage Conditions: At -20°C for 1 year. After reconstitution, at 4°C for 1 month. It can also be aliquotted and stored frozen at -20°C for a longer time. Avoid freeze-thaw cycles.
Recommended Storage Buffer: NaCl

Request SDS/MSDS

To request an SDS/MSDS form for this product, please contact our Technical Support department at: technical@vectorlabs.com.