AMPK beta 1 antibody Western blot. All lanes: Anti AMPK beta 1 at 0.5 ug/ml. Lane 1: JURKAT Whole Cell Lysate at 40 ug. Lane 2: PANC Whole Cell Lysate at 40 ug. Lane 3: K562 Whole Cell Lysate at 40 ug. Predicted band size: 38 kD. Observed band size: 38 kD.
PRKAB1 / AMPK Beta 1 Antibody (aa32-68)
Primary AntibodyLSBio Guarantee
| Antibody: | Rabbit Polyclonal |
| Applications: | Western Blot |
| Reactivity: | Bovine, Dog, Guinea Pig, Human, Mammal (Other), Sheep |
| Format: | Lyophilized |
$480.00each
Catalog Number: LS-C407950-100
Catalog Number: LS-C407950
For bulk orders or custom formulations:
Request a QuoteOverview
- Description
- AMPK Beta 1 antibody LS-C407950 is an unconjugated rabbit polyclonal antibody to AMPK Beta 1 (PRKAB1) (aa32-68) from human. It is reactive with human, bat, bovine and other species. Validated for WB.
- Application
- WB
- Reactivity
- Bov, Can, GP, Hu, Mml, Sh
- Intended Use
- RUO
- Guarantees
- This antibody carries the LSBio 100% Guarantee. ✓
- Category
- Antibodies > Primary Antibodies > Polyclonal Antibodies
- Alternative Names
- AMPK beta 1 | AMPK subunit beta-1 | AMPKb | PRKAB1 | AMPK | AMPK beta -1 chain | HAMPKb
- UniProt Number
- Q9Y478
- NCBI GenBank
- NM_006253, NP_006244.2
- SwissProt
- Q9Y478
Target
- Target
- Human PRKAB1 / AMPK Beta 1
- Antigen Species
- Hu
- Gene Name
- PRKAB1
Antibody
- Host Species
- Rb
- Clonality
- Polyclonal
Immunogen
- Immunogen
- A synthetic peptide corresponding to a sequence at the N-Terminus of human AMPK beta 1 (32-68 aa DRPKILMDSPEDADLFHSEEIKAPEKEEFLAWQHDLE), different from the related mouse sequence by one amino acid, and from the related rat sequence by three amino acids.
- Immunogen Type
- SP-Lin
Format
- Conjugate/Label
- Unconj
- Format
- Lyophilized
- Formulation
- Lyophilized from 0.2mg Na2HPO4, 5mg BSA, 0.9mg NaCl, 0.05mg sodium azide.
- Preservative
- Yes
- Purification Method
- AP
Storage & Handling
- Storage Conditions
- At -20°C for 1 year. After reconstitution, at 4°C for 1 month. It can also be aliquotted and stored frozen at -20°C for a longer time. Avoid freeze-thaw cycles.
- Recommended Storage Buffer
- NaCl