Human Apolipoprotein H Antibody (IgA) ELISA Kit (Sandwich ELISA)
Catalog Number: LS-F67373-1
1 plate / $591.00
Reactivity: Human
Detection Method Colorimetric
Format: 96-Well Strip Plate
PKLR antibody Western blot. All lanes: Anti PKLR at 0.5 ug/ml. Lane 1: Rat Liver Tissue Lysate at 50 ug. Lane 2: Mouse Liver Tissue Lysate at 50 ug. Predicted band size: 62 kD. Observed band size: 62 kD.
PKLR Antibody (aa522-552)
Primary AntibodyLSBio Guarantee
| Antibody: | Rabbit Polyclonal |
| Applications: | Immunohistochemistry (general), Immunohistochemistry, Paraffin, Western Blot |
| Reactivity: | Dog, Hamster, Human, Mouse, Rat |
| Format: | Lyophilized |
$480.00each
Catalog Number: LS-C407712-100
Catalog Number: LS-C407712
For bulk orders or custom formulations:
Request a QuoteOverview
- Description
- PKLR antibody LS-C407712 is an unconjugated rabbit polyclonal antibody to PKLR (aa522-552) from human. It is reactive with human, mouse, rat and other species. Validated for IHC and WB.
- Application
- IHC, IHC-P, WB
- Reactivity
- Can, Ham, Hu, Ms, Rt
- Intended Use
- RUO
- Guarantees
- This antibody carries the LSBio 100% Guarantee. ✓
- Category
- Antibodies > Primary Antibodies > Polyclonal Antibodies
- Alternative Names
- PKL | PKLR | Pyruvate kinase, liver and RBC | Pyruvate kinase type L | Red cell/liver pyruvate kinase | RPK | PK1 | PKR | Pyruvate kinase 1 | Pyruvate kinase isozymes R/L | R-type/L-type pyruvate kinase | PKRL | Pyruvate kinase isozyme R/L
- UniProt Number
- P30613
- NCBI GenBank
- NM_000298, NP_000289.1
- SwissProt
- P30613
Target
- Target
- Human PKLR
- Antigen Species
- Hu
- Gene Name
- PKLR
Antibody
- Host Species
- Rb
- Clonality
- Polyclonal
Immunogen
- Immunogen
- A synthetic peptide corresponding to a sequence at the C-Terminus of human PKLR (522-552 aa EAIWADDVDRRVQFGIESGKLRGFLRVGDLV), different from the related mouse sequence by one amino acid, and identical to the rat sequence.
- Immunogen Type
- SP-Lin
Format
- Conjugate/Label
- Unconj
- Format
- Lyophilized
- Formulation
- Lyophilized from 0.2mg Na2HPO4, 5mg BSA, 0.9mg NaCl, 0.05mg sodium azide.
- Preservative
- Yes
- Purification Method
- AP
Storage & Handling
- Storage Conditions
- At -20°C for 1 year. After reconstitution, at 4°C for 1 month. It can also be aliquotted and stored frozen at -20°C for a longer time. Avoid freeze-thaw cycles.
- Recommended Storage Buffer
- NaCl
