PDGFRA antibody Western blot. All lanes: Anti PDGFRA at 0.5 ug/ml. Lane 1: Rat Brain Tissue Lysate at 50 ug. Lane 2: HELA Whole Cell Lysate at 40 ug. Lane 3: NIH3T3 Whole Cell Lysate at 40 ug. Predicted band size: 180 kD. Observed band size: 180 kD.
PDGFRA / PDGFR Alpha Antibody (aa968-1002)
Primary AntibodyLSBio Guarantee
| Antibody: | Rabbit Polyclonal |
| Applications: | Immunohistochemistry (general), Immunohistochemistry, Paraffin, Western Blot |
| Reactivity: | Bovine, Dog, Horse, Human, Mouse, Pig, Rat, Sheep |
| Format: | Lyophilized |
$480.00each
Catalog Number: LS-C407983-100
Catalog Number: LS-C407983
For bulk orders or custom formulations:
Request a QuoteOverview
- Description
- PDGFR Alpha antibody LS-C407983 is an unconjugated rabbit polyclonal antibody to PDGFR Alpha (PDGFRA) (aa968-1002) from human. It is reactive with human, mouse, rat and other species. Validated for IHC and WB.
- Application
- IHC, IHC-P, WB
- Reactivity
- Bov, Can, Hr, Hu, Ms, Por, Rt, Sh
- Intended Use
- RUO
- Guarantees
- This antibody carries the LSBio 100% Guarantee. ✓
- Category
- Antibodies > Primary Antibodies > Polyclonal Antibodies
- Alternative Names
- CD140A | CD140a antigen | PDGFalphaR | PDGFR2 | PDGFRalpha | AlphaPDGFR | RHEPDGFRA | PDGF receptor alpha | PDGFR-2 | PDGFRA/BCR fusion | APDGFR | Pdgf alpha-receptor | PDGF-R-alpha | PDGFR-alpha | PDGFRA
- UniProt Number
- P16234
- NCBI GenBank
- NM_006206, NP_006197.1
- SwissProt
- P16234
Target
- Target
- Human PDGFRA / PDGFR Alpha
- Antigen Species
- Hu
- Epitope
- Detected in platelets (at protein level). Widely expressed. Detected in brain, fibroblasts, smooth muscle, heart, and embryo. Expressed in primary and metastatic colon tumors and in normal colon tissue. .
- Gene Name
- PDGFRA
Antibody
- Host Species
- Rb
- Clonality
- Polyclonal
Immunogen
- Immunogen
- A synthetic peptide corresponding to a sequence at the C-Terminus of human PDGFRA (968-1002 aa DFLKSDHPAVARMRVDSDNAYIGVTYKNEEDKLKD), identical to the related mouse sequence, and different from the related rat sequence by one amino acid.
- Immunogen Type
- SP-Lin
Format
- Conjugate/Label
- Unconj
- Format
- Lyophilized
- Formulation
- Lyophilized from 0.2mg Na2HPO4, 5mg BSA, 0.9mg NaCl, 0.05mg sodium azide.
- Preservative
- Yes
- Purification Method
- AP
Storage & Handling
- Storage Conditions
- At -20°C for 1 year. After reconstitution, at 4°C for 1 month. It can also be aliquotted and stored frozen at -20°C for a longer time. Avoid freeze-thaw cycles.
- Recommended Storage Buffer
- NaCl