Lck antibody Western blot. All lanes: Anti Lck at 0.5 ug/ml. Lane 1: HUT Whole Cell Lysate at 40 ug. Lane 2: JURKAT Whole Cell Lysate at 40 ug. Lane 3: RAJI Whole Cell Lysate at 40 ug. Lane 4: CEM Whole Cell Lysate at 40 ug. Lane 5: K562 Whole Cell Lysate at 40 ug. Predicted band size: 58 kD. Observed band size: 58 kD.
p56lck / LCK Antibody (aa468-506)
Primary AntibodyLSBio Guarantee
| Antibody: | Rabbit Polyclonal |
| Applications: | Immunohistochemistry (general), Immunohistochemistry, Paraffin, Western Blot |
| Reactivity: | Human, Mouse, Rat |
| Format: | Lyophilized |
$480.00each
Catalog Number: LS-C408021-100
Catalog Number: LS-C408021
For bulk orders or custom formulations:
Request a QuoteOverview
- Description
- LCK antibody LS-C408021 is an unconjugated rabbit polyclonal antibody to LCK (p56lck) (aa468-506) from human. It is reactive with human, mouse and rat. Validated for IHC and WB.
- Application
- IHC, IHC-P, WB
- Reactivity
- Hu, Ms, Rt
- Intended Use
- RUO
- Guarantees
- This antibody carries the LSBio 100% Guarantee. ✓
- Category
- Antibodies > Primary Antibodies > Polyclonal Antibodies
- Alternative Names
- LCK | Lck kinase | LSK | p56-LCK | Pp58lck | Tyrosine-protein kinase Lck | p56lck | Protein YT16 | Proto-oncogene Lck | YT16
- UniProt Number
- P06239
- NCBI GenBank
- NM_005356, NP_005347.3
- SwissProt
- P06239
Target
- Target
- Human p56lck / LCK
- Antigen Species
- Hu
- Epitope
- Expressed specifically in lymphoid cells.
- Gene Name
- LCK
Antibody
- Host Species
- Rb
- Clonality
- Polyclonal
Immunogen
- Immunogen
- A synthetic peptide corresponding to a sequence at the C-Terminus of human Lck (468-506 aa ELYQLMRLCWKERPEDRPTFDYLRSVLEDFFTATEGQYQ), different from the related mouse and rat sequences by three amino acids.
- Immunogen Type
- SP-Lin
Format
- Conjugate/Label
- Unconj
- Format
- Lyophilized
- Formulation
- Lyophilized from 0.2mg Na2HPO4, 5mg BSA, 0.9mg NaCl, 0.05mg sodium azide.
- Preservative
- Yes
- Purification Method
- AP
Storage & Handling
- Storage Conditions
- At -20°C for 1 year. After reconstitution, at 4°C for 1 month. It can also be aliquotted and stored frozen at -20°C for a longer time. Avoid freeze-thaw cycles.
- Recommended Storage Buffer
- NaCl