NM23A antibody Western blot. All lanes: Anti NM23A at 0.5 ug/ml. Lane 1: Rat Brain Tissue Lysate at 50 ug. Lane 2: Rat Liver Tissue Lysate at 50 ug. Lane 3: HELA Whole Cell Lysate at 40 ug. Lane 4: NIH3T3 Whole Cell Lysate at 40 ug. Predicted band size: 20 kD. Observed band size: 20 kD.
NME1 / NM23 Antibody (aa26-58)
Primary AntibodyLSBio Guarantee
| Antibody: | Rabbit Polyclonal |
| Applications: | Western Blot |
| Reactivity: | Human, Mouse, Rat |
| Format: | Lyophilized |
$480.00each
Catalog Number: LS-C408145-100
Catalog Number: LS-C408145
For bulk orders or custom formulations:
Request a QuoteOverview
- Description
- NM23 antibody LS-C408145 is an unconjugated rabbit polyclonal antibody to NM23 (NME1) (aa26-58) from human. It is reactive with human, mouse and rat. Validated for WB.
- Application
- WB
- Reactivity
- Hu, Ms, Rt
- Intended Use
- RUO
- Guarantees
- This antibody carries the LSBio 100% Guarantee. ✓
- Category
- Antibodies > Primary Antibodies > Polyclonal Antibodies
- Alternative Names
- AWD | NDKA | NB | NDK A | NM23-H1 | NME1 | NDP kinase A | NDPK-A | NDPKA | GAAD | Granzyme A-activated DNase | NBS | NM23
- UniProt Number
- P15531
- NCBI GenBank
- NM_000269, NP_000260.1
- SwissProt
- P15531
Target
- Target
- Human NME1 / NM23
- Antigen Species
- Hu
- Epitope
- Isoform 1 is expressed in heart, brain, placenta, lung, liver, skeletal muscle, pancreas, spleen and thymus. Expressed in lung carcinoma cell lines but not in normal lung tissues. Isoform 2 is ubiquitously expressed and its expression is also related to tumor differentiation. Isoform 3 is ubiquitously expressed. .
- Gene Name
- NME1
Antibody
- Host Species
- Rb
- Clonality
- Polyclonal
Immunogen
- Immunogen
- A synthetic peptide corresponding to a sequence at the N-Terminus of human NM23A (26-58 aa KRFEQKGFRLVGLKFMQASEDLLKEHYVDLKDR), different from the related mouse and rat sequences by two amino acids.
- Immunogen Type
- SP-Lin
Format
- Conjugate/Label
- Unconj
- Format
- Lyophilized
- Formulation
- Lyophilized from 0.2mg Na2HPO4, 5mg BSA, 0.9mg NaCl, 0.05mg sodium azide.
- Preservative
- Yes
- Purification Method
- AP
Storage & Handling
- Storage Conditions
- At -20°C for 1 year. After reconstitution, at 4°C for 1 month. It can also be aliquotted and stored frozen at -20°C for a longer time. Avoid freeze-thaw cycles.
- Recommended Storage Buffer
- NaCl