Polyclonal Rabbit anti-Human SLC5A11 / SMIT2 Antibody (WB)
Catalog Number: LS-C748223
2 sizes / from $281.00
Antibody: Rabbit Polyclonal
Applications: Immunohistochemistry (general), Western Blot
Reactivity: Human, Mouse, Rat
Format: Liquid
p95 NBS1 antibody Western blot. All lanes: Anti p95 NBS1 at 0.5 ug/ml. Lane 1: Rat Testis Tissue Lysate at 50 ug. Lane 2: Rat Brain Tissue Lysate at 50 ug. Lane 3: Rat Liver Tissue Lysate at 50 ug. Lane 4: Mouse Testis Tissue Lysate at 50 ug. Lane 5: HELA Whole Cell Lysate at 40 ug. Lane 6: A431 Whole Cell Lysate at 40 ug. Lane 7: HUT Whole Cell Lysate at 40 ug. Predicted band size: 95 kD. Observed band size: 95 kD.
Polyclonal Rabbit anti-Human NBN / Nibrin Antibody (aa714-745, IHC, WB)
Primary AntibodyLSBio Guarantee
| Antibody: | Rabbit Polyclonal |
| Applications: | Immunohistochemistry (general), Immunohistochemistry, Paraffin, Western Blot |
| Reactivity: | Human, Mouse, Rat |
| Format: | Lyophilized |
$480.00each
Catalog Number: LS-C407828-100
Catalog Number: LS-C407828
For bulk orders or custom formulations:
Request a QuoteOverview
- Description
- Nibrin antibody LS-C407828 is an unconjugated rabbit polyclonal antibody to Nibrin (NBN) (aa714-745) from human. It is reactive with human, mouse and rat. Validated for IHC and WB.
- Application
- IHC, IHC-P, WB
- Reactivity
- Hu, Ms, Rt
- Intended Use
- RUO
- Guarantees
- This antibody carries the LSBio 100% Guarantee. ✓
- Category
- Antibodies > Primary Antibodies > Polyclonal Antibodies
- Alternative Names
- ATV | AT-V2 | NBN | Nibrin | NBS1 | AT-V1 | NBS | p95
- UniProt Number
- O60934
- NCBI GenBank
- NM_002485, NP_002476.2
- SwissProt
- O60934
Target
- Target
- Human NBN / Nibrin
- Antigen Species
- Hu
- Epitope
- Ubiquitous. Expressed at high levels in testis.
- Gene Name
- NBN
Antibody
- Host Species
- Rb
- Clonality
- Polyclonal
Immunogen
- Immunogen
- A synthetic peptide corresponding to a sequence at the C-Terminus of human p95 NBS1 (714-745 aa RKNTELEEWLRQEMEVQNQHAKEESLADDLFR), different from the related mouse sequence by three amino acids, and from the related rat sequence by five amino acids.
- Immunogen Type
- SP-Lin
Format
- Conjugate/Label
- Unconj
- Format
- Lyophilized
- Formulation
- Lyophilized from 0.2mg Na2HPO4, 5mg BSA, 0.9mg NaCl, 0.05mg sodium azide.
- Preservative
- Yes
- Purification Method
- AP
Storage & Handling
- Storage Conditions
- At -20°C for 1 year. After reconstitution, at 4°C for 1 month. It can also be aliquotted and stored frozen at -20°C for a longer time. Avoid freeze-thaw cycles.
- Recommended Storage Buffer
- NaCl
