MMP9 antibody Western blot. All lanes: Anti MMP9 at 0.5 ug/ml. WB: SW620 Whole Cell Lysate at 40 ug. Predicted band size: 67 kD. Observed band size: 67 kD.
MMP9 / Gelatinase B Antibody (aa633-667)
Primary AntibodyLSBio Guarantee
| Antibody: | Rabbit Polyclonal |
| Applications: | Enzyme-Linked Immunosorbent Assay, Western Blot |
| Reactivity: | Human |
| Format: | Lyophilized |
$480.00each
Catalog Number: LS-C407880-100
Catalog Number: LS-C407880
For bulk orders or custom formulations:
Request a QuoteOverview
- Description
- Gelatinase B antibody LS-C407880 is an unconjugated rabbit polyclonal antibody to human Gelatinase B (MMP9) (aa633-667). Validated for ELISA and WB.
- Application
- ELISA, WB
- Reactivity
- Hu
- Intended Use
- RUO
- Guarantees
- This antibody carries the LSBio 100% Guarantee. ✓
- Category
- Antibodies > Primary Antibodies > Polyclonal Antibodies
- Alternative Names
- 92kd gelatinase | 92 kDa gelatinase | Matrix metalloproteinase-9 | MMP9 | MMP-9 | CLG4B | Gelatinase B | GELB | Macrophage gelatinase | MANDP2
- Recommended Dilution: ELISA
- 0.1 - 0.5 ug/ml
- UniProt Number
- P14780
- NCBI GenBank
- NM_004994, NP_004985.2
- SwissProt
- P14780
Target
- Target
- Human MMP9 / Gelatinase B
- Antigen Species
- Hu
- Epitope
- Produced by normal alveolar macrophages and granulocytes.
- Gene Name
- MMP9
Antibody
- Host Species
- Rb
- Clonality
- Polyclonal
Immunogen
- Immunogen
- A synthetic peptide corresponding to a sequence at the C-Terminus of human MMP-9 (633-667 aa WRFDVKAQMVDPRSASEVDRMFPGVPLDTHDVFQY), different from the related mouse sequence by fourteen amino acids, and from the related rat sequence by sixteen amino acids.
- Immunogen Type
- SP-Lin
Format
- Conjugate/Label
- Unconj
- Format
- Lyophilized
- Formulation
- Lyophilized from 0.2mg Na2HPO4, 5mg BSA, 0.9mg NaCl, 0.05mg sodium azide.
- Preservative
- Yes
- Purification Method
- AP
Storage & Handling
- Storage Conditions
- At -20°C for 1 year. After reconstitution, at 4°C for 1 month. It can also be aliquotted and stored frozen at -20°C for a longer time. Avoid freeze-thaw cycles.
- Recommended Storage Buffer
- NaCl