Polyclonal Rabbit anti-Human SLC5A11 / SMIT2 Antibody (WB)
Catalog Number: LS-C748223
2 sizes / from $281.00
Antibody: Rabbit Polyclonal
Applications: Immunohistochemistry (general), Western Blot
Reactivity: Human, Mouse, Rat
Format: Liquid
MMP8 antibody Western blot. All lanes: Anti MMP8 at 0.5 ug/ml. Lane 1: Mouse Testis Tissue Lysate at 50 ug. Lane 2: NIH3T3 Whole Cell Lysate at 40 ug. Lane 3: HEPA Whole Cell Lysate at 40 ug. Lane 4: NRK Whole Cell Lysate at 40 ug. Predicted band size: 55 kD. Observed band size: 55 kD.
Polyclonal Rabbit anti-Mouse MMP8 Antibody (aa120-157, IHC, WB)
Primary AntibodyLSBio Guarantee
| Antibody: | Rabbit Polyclonal |
| Applications: | Enzyme-Linked Immunosorbent Assay, Immunohistochemistry (general), Immunohistochemistry, Paraffin, Western Blot |
| Reactivity: | Mouse, Rat |
| Format: | Lyophilized |
$480.00each
Catalog Number: LS-C407939-100
Catalog Number: LS-C407939
For bulk orders or custom formulations:
Request a QuoteOverview
- Description
- MMP8 antibody LS-C407939 is an unconjugated rabbit polyclonal antibody to MMP8 (aa120-157) from mouse. It is reactive with mouse and rat. Validated for ELISA, IHC and WB.
- Application
- ELISA, IHC, IHC-P, WB
- Reactivity
- Ms, Rt
- Intended Use
- Research Use Only
- Guarantees
- This antibody carries the LSBio 100% Guarantee. ✓
- Category
- Antibodies > Primary Antibodies > Polyclonal Antibodies
- Alternative Names
- CLG1 | HNC | Matrix metalloproteinase-8 | MMP8 | MMP-8 | Neutrophil collagenase | PMNL collagenase | PMNL-CL
- Recommended Dilution: ELISA
- 0.1 - 0.5 ug/ml
- UniProt Number
- P22894
- NCBI GenBank
- NM_002424 | NP_002415.1
- SwissProt
- P22894
Target
- Target
- Mouse MMP8
- Antigen Species
- Mouse
- Epitope
- Neutrophils. Expressed in uterus. Low levels in kidney and muscle.
- Gene Name
- MMP8
Antibody
- Host Species
- Rabbit
- Clonality
- Polyclonal
Immunogen
- Immunogen
- A synthetic peptide corresponding to a sequence at the N-Terminus of mouse MMP-8 (120-157 aa HTPQLSRAEVKTAIEKAFHVWSVASPLTFTEILQGEAD), different from the related human sequence by eleven amino acids, and from the related rat sequence by nine amino acids.
- Immunogen Type
- Synthetic Peptide (Linear)
Format
- Conjugate/Label
- Unconjugated
- Format
- Lyophilized
- Formulation
- Lyophilized from 0.2mg Na2HPO4, 5mg BSA, 0.9mg NaCl, 0.05mg sodium azide.
- Preservative
- Yes
- Purification Method
- Affinity Purified
Storage & Handling
- Storage Conditions
- At -20°C for 1 year. After reconstitution, at 4°C for 1 month. It can also be aliquotted and stored frozen at -20°C for a longer time. Avoid freeze-thaw cycles.
- Recommended Storage Buffer
- NaCl
