Human Apolipoprotein H Antibody (IgA) ELISA Kit (Sandwich ELISA)
Catalog Number: LS-F67373-1
1 plate / $591.00
Reactivity: Human
Detection Method Colorimetric
Format: 96-Well Strip Plate
MCM8 antibody Western blot. All lanes: Anti MCM8 at 0.5 ug/ml. Lane 1: A549 Whole Cell Lysate at 40 ug. Lane 2: SW620 Whole Cell Lysate at 40 ug. Lane 3: HELA Whole Cell Lysate at 40 ug. Lane 4: PANC Whole Cell Lysate at 40 ug. Lane 5: HEPG2 Whole Cell Lysate at 40 ug. Predicted band size: 94 kD. Observed band size: 94 kD.
MCM8 Antibody (aa809-840)
Primary AntibodyLSBio Guarantee
| Antibody: | Rabbit Polyclonal |
| Applications: | Western Blot |
| Reactivity: | Bovine, Horse, Human, Pig, Sheep |
| Format: | Lyophilized |
$480.00each
Catalog Number: LS-C407934-100
Catalog Number: LS-C407934
For bulk orders or custom formulations:
Request a QuoteOverview
- Description
- MCM8 antibody LS-C407934 is an unconjugated rabbit polyclonal antibody to MCM8 (aa809-840) from human. It is reactive with human, bovine, horse and other species. Validated for WB.
- Application
- WB
- Reactivity
- Bov, Hr, Hu, Por, Sh
- Intended Use
- RUO
- Guarantees
- This antibody carries the LSBio 100% Guarantee. ✓
- Category
- Antibodies > Primary Antibodies > Polyclonal Antibodies
- Alternative Names
- C20orf154 | Minichromosome maintenance 8 | REC homolog | MCM8 | DJ967N21.5 | Rec
- UniProt Number
- Q9UJA3
- NCBI GenBank
- NM_032485
- SwissProt
- Q9UJA3
Target
- Target
- Human MCM8
- Antigen Species
- Hu
- Epitope
- Highest levels in placenta, lung and pancreas. Low levels in skeletal muscle and kidney. Expressed in various tumors with highest levels in colon and lung cancers. .
- Gene Name
- MCM8
Antibody
- Host Species
- Rb
- Clonality
- Polyclonal
Immunogen
- Immunogen
- A synthetic peptide corresponding to a sequence at the C-Terminus of human MCM8 (809-840 aa IQVADFENFIGSLNDQGYLLKKGPKVYQLQTM), different from the related mouse and rat sequences by one amino acid.
- Immunogen Type
- SP-Lin
Format
- Conjugate/Label
- Unconj
- Format
- Lyophilized
- Formulation
- Lyophilized from 0.2mg Na2HPO4, 5mg BSA, 0.9mg NaCl, 0.05mg sodium azide.
- Preservative
- Yes
- Purification Method
- AP
Storage & Handling
- Storage Conditions
- At -20°C for 1 year. After reconstitution, at 4°C for 1 month. It can also be aliquotted and stored frozen at -20°C for a longer time. Avoid freeze-thaw cycles.
- Recommended Storage Buffer
- NaCl
