Polyclonal Rabbit anti-Human SLC5A11 / SMIT2 Antibody (WB)
Catalog Number: LS-C748223
2 sizes / from $281.00
Antibody: Rabbit Polyclonal
Applications: Immunohistochemistry (general), Western Blot
Reactivity: Human, Mouse, Rat
Format: Liquid
MAOA antibody Western blot. All lanes: Anti MAOA at 0.5 ug/ml. Lane 1: Rat Kidney Tissue Lysate at 50 ug. Lane 2: Mouse Kidney Tissue Lysate at 50 ug. Lane 3: COLO320 Whole Cell Lysate at 40 ug. Lane 4: HEPG2 Whole Cell Lysate at 40 ug. Lane 5: HEPA Whole Cell Lysate at 40 ug. Predicted band size: 60 kD. Observed band size: 60 kD.
Polyclonal Rabbit anti-Human MAOA / Monoamine Oxidase Antibody (aa457-493, IHC, WB)
Primary AntibodyLSBio Guarantee
| Antibody: | Rabbit Polyclonal |
| Applications: | Immunohistochemistry (general), Immunohistochemistry, Paraffin, Western Blot |
| Reactivity: | Human, Mouse, Rat |
| Format: | Lyophilized |
$480.00each
Catalog Number: LS-C407876-100
Catalog Number: LS-C407876
For bulk orders or custom formulations:
Request a QuoteOverview
- Description
- Monoamine Oxidase antibody LS-C407876 is an unconjugated rabbit polyclonal antibody to Monoamine Oxidase (MAOA) (aa457-493) from human. It is reactive with human, mouse and rat. Validated for IHC and WB.
- Application
- IHC, IHC-P, WB
- Reactivity
- Hu, Ms, Rt
- Intended Use
- Research Use Only
- Guarantees
- This antibody carries the LSBio 100% Guarantee. ✓
- Category
- Antibodies > Primary Antibodies > Polyclonal Antibodies
- Alternative Names
- MAO-A | MAOA | Monoamine Oxidase | Monoamine oxidase A | Monoamine oxidase type A
- UniProt Number
- P21397
- NCBI GenBank
- NM_000240 | NP_000231.1
- SwissProt
- P21397
Target
- Target
- Human MAOA / Monoamine Oxidase
- Antigen Species
- Human
- Epitope
- Heart, liver, duodenum, blood vessels and kidney.
- Gene Name
- MAOA
Antibody
- Host Species
- Rabbit
- Clonality
- Polyclonal
Immunogen
- Immunogen
- A synthetic peptide corresponding to a sequence at the C-Terminus of human MAOA (457-493 aa REVLNGLGKVTEKDIWVQEPESKDVPAVEITHTFWER), different from the related mouse sequence by five amino acids, and from the related rat sequence by six amino acids.
- Immunogen Type
- Synthetic Peptide (Linear)
Format
- Conjugate/Label
- Unconjugated
- Format
- Lyophilized
- Formulation
- Lyophilized from 0.2mg Na2HPO4, 5mg BSA, 0.9mg NaCl, 0.05mg sodium azide.
- Preservative
- Yes
- Purification Method
- Affinity Purified
Storage & Handling
- Storage Conditions
- At -20°C for 1 year. After reconstitution, at 4°C for 1 month. It can also be aliquotted and stored frozen at -20°C for a longer time. Avoid freeze-thaw cycles.
- Recommended Storage Buffer
- NaCl
