Lysozyme antibody Western blot. All lanes: Anti Lysozyme at 0.5 ug/ml. Lane 1: Rat Intestine Tissue Lysate at 50 ug. Lane 2: Rat Kidney Tissue Lysate at 50 ug. Lane 3: Rat Liver Tissue Lysate at 50 ug. Lane 4: HELA Whole Cell Lysate at 40 ug. Lane 5: SW620 Whole Cell Lysate at 40 ug. Lane 6: 293T Whole Cell Lysate at 40 ug. Lane 7: HEPG2 Whole Cell Lysate at 40 ug. Predicted band size: 17 kD. Observed band size: 17 kD.
LYZ / Lysozyme Antibody (aa106-141)
Primary AntibodyLSBio Guarantee
| Antibody: | Rabbit Polyclonal |
| Applications: | Immunohistochemistry (general), Immunohistochemistry, Paraffin, Western Blot |
| Reactivity: | Human, Rat |
| Format: | Lyophilized |
$480.00each
Catalog Number: LS-C407874-100
Catalog Number: LS-C407874
For bulk orders or custom formulations:
Request a QuoteOverview
- Description
- Lysozyme antibody LS-C407874 is an unconjugated rabbit polyclonal antibody to Lysozyme (LYZ) (aa106-141) from human. It is reactive with human and rat. Validated for IHC and WB. Cited in 1 publication.
- Application
- IHC, IHC-P, WB
- Reactivity
- Hu, Rt
- Intended Use
- RUO
- Guarantees
- This antibody carries the LSBio 100% Guarantee. ✓
- Category
- Antibodies > Primary Antibodies > Polyclonal Antibodies
- Alternative Names
- 1,4-beta-N-acetylmuramidase C | LZM | Lysozyme | Lysozyme (renal amyloidosis) | LYZ | Renal amyloidosis | Lysozyme C | Gal d 4 | P00698
- UniProt Number
- P61626
- NCBI GenBank
- NM_000239, NP_000230.1
- SwissProt
- P61626
Target
- Target
- Human LYZ / Lysozyme
- Antigen Species
- Hu
- Gene Name
- LYZ
Antibody
- Host Species
- Rb
- Clonality
- Polyclonal
Immunogen
- Immunogen
- A synthetic peptide corresponding to a sequence at the C-Terminus of human Lysozyme (106-141 aa NIADAVACAKRVVRDPQGIRAWVAWRNRCQNRDVRQ).
- Immunogen Type
- SP-Lin
Format
- Conjugate/Label
- Unconj
- Format
- Lyophilized
- Formulation
- Lyophilized from 0.2mg Na2HPO4, 5mg BSA, 0.9mg NaCl, 0.05mg sodium azide.
- Preservative
- Yes
- Purification Method
- AP
Storage & Handling
- Storage Conditions
- At -20°C for 1 year. After reconstitution, at 4°C for 1 month. It can also be aliquotted and stored frozen at -20°C for a longer time. Avoid freeze-thaw cycles.
- Recommended Storage Buffer
- NaCl
Comparison of Different In Vivo Incubation Sites to Produce Tissue-Engineered Small Intestine. Liu Y, Cromeens BP, Wang Y, Fisher K, Johnson J, Chakroff J, Besner GE. Tissue engineering. Part A. 2018 July;4:1138-1147. PubMed: 29383981 PMC: PMC6033308