LIMK1 antibody Western blot. All lanes: Anti LIMK1 at 0.5 ug/ml. Lane 1: Rat Brain Tissue Lysate at 50 ug. Lane 2: Mouse Gaster Tissue Lysate at 50 ug. Lane 3: HELA Whole Cell Lysate at 40 ug. Lane 4: U87 Whole Cell Lysate at 40 ug. Lane 5: SKOV Whole Cell Lysate at 40 ug. Predicted band size: 72 kD. Observed band size: 72 kD.
LIMK1 / LIMK Antibody (aa599-634)
Primary AntibodyLSBio Guarantee
| Antibody: | Rabbit Polyclonal |
| Applications: | Western Blot |
| Reactivity: | Human, Mouse |
| Format: | Lyophilized |
$480.00each
Catalog Number: LS-C407928-100
Catalog Number: LS-C407928
For bulk orders or custom formulations:
Request a QuoteOverview
- Description
- LIMK antibody LS-C407928 is an unconjugated rabbit polyclonal antibody to LIMK (LIMK1) (aa599-634) from human. It is reactive with human and mouse. Validated for WB.
- Application
- WB
- Reactivity
- Hu, Ms
- Intended Use
- RUO
- Guarantees
- This antibody carries the LSBio 100% Guarantee. ✓
- Category
- Antibodies > Primary Antibodies > Polyclonal Antibodies
- Alternative Names
- LIM domain kinase 1 | Lim kinase 1 | LIMK-1 | LIM kinase | LIMK1 | LIMK
- UniProt Number
- P53667
- NCBI GenBank
- NM_002314, NP_002305.1
- SwissProt
- P53667
Target
- Target
- Human LIMK1 / LIMK
- Antigen Species
- Hu
- Epitope
- Highest expression in both adult and fetal nervous system. Detected ubiquitously throughout the different regions of adult brain, with highest levels in the cerebral cortex. Expressed to a lesser extent in heart and skeletal muscle.
- Gene Name
- LIMK1
Antibody
- Host Species
- Rb
- Clonality
- Polyclonal
Immunogen
- Immunogen
- A synthetic peptide corresponding to a sequence at the C-Terminus of human LIMK1 (599-634 aa KLEHWLETLRMHLAGHLPLGPQLEQLDRGFWETYRR), different from the related mouse sequence by three amino acids, and from the related rat sequence by two amino acids.
- Immunogen Type
- SP-Lin
Format
- Conjugate/Label
- Unconj
- Format
- Lyophilized
- Formulation
- Lyophilized from 0.2mg Na2HPO4, 5mg BSA, 0.9mg NaCl, 0.05mg sodium azide.
- Preservative
- Yes
- Purification Method
- AP
Storage & Handling
- Storage Conditions
- At -20°C for 1 year. After reconstitution, at 4°C for 1 month. It can also be aliquotted and stored frozen at -20°C for a longer time. Avoid freeze-thaw cycles.
- Recommended Storage Buffer
- NaCl