Polyclonal Rabbit anti-Human SLC5A11 / SMIT2 Antibody (WB)
Catalog Number: LS-C748223
2 sizes / from $281.00
Antibody: Rabbit Polyclonal
Applications: Immunohistochemistry (general), Western Blot
Reactivity: Human, Mouse, Rat
Format: Liquid
Cytokeratin 19 antibody Western blot. All lanes: Anti Cytokeratin 19 at 0.5 ug/ml. Lane 1: Human Placenta Tissue Lysate at 50 ug. Lane 2: MCF-7 Whole Cell Lysate at 40 ug. Predicted band size: 44 kD. Observed band size: 44 kD.
Polyclonal Rabbit anti-Human KRT19 / CK19 / Cytokeratin 19 Antibody (aa334-372, IHC, WB)
Primary AntibodyLSBio Guarantee
| Antibody: | Rabbit Polyclonal |
| Applications: | Immunohistochemistry (general), Immunohistochemistry, Paraffin, Western Blot |
| Reactivity: | Human, Mouse, Rat |
| Format: | Lyophilized |
$480.00each
Catalog Number: LS-C407927-100
Catalog Number: LS-C407927
For bulk orders or custom formulations:
Request a QuoteOverview
- Description
- Cytokeratin 19 antibody LS-C407927 is an unconjugated rabbit polyclonal antibody to Cytokeratin 19 (KRT19 / CK19) (aa334-372) from human. It is reactive with human, mouse and rat. Validated for IHC and WB.
- Application
- IHC, IHC-P, WB
- Reactivity
- Hu, Ms, Rt
- Intended Use
- RUO
- Guarantees
- This antibody carries the LSBio 100% Guarantee. ✓
- Category
- Antibodies > Primary Antibodies > Polyclonal Antibodies
- Alternative Names
- CK19 | Cytokeratin 19 | Cytokeratin-19 | Keratin 19 | KRT19 | Keratin-19 | CK-19 | K19 | K1CS | Keratin, type I, 40-kd
- UniProt Number
- P08727
- NCBI GenBank
- NM_002276, NP_002267.2
- SwissProt
- P08727
Target
- Target
- Human KRT19 / CK19 / Cytokeratin 19
- Antigen Species
- Hu
- Epitope
- Expressed in a defined zone of basal keratinocytes in the deep outer root sheath of hair follicles. Also observed in sweat gland and mammary gland ductal and secretory cells, bile ducts, gastrointestinal tract, bladder urothelium, oral epithelia, esophagus, ectocervical epithelium (at protein level). Expressed in epidermal basal cells, in nipple epidermis and a defined region of the hair follicle. Also seen in a subset of vascular wall cells in both the veins and artery of human umbilical cord, and in umbilical cord vascular smooth muscle. Observed in muscle fibers accumulating in the costameres of myoplasm at the sarcolemma in structures that contain dystrophin and spectrin. .
- Gene Name
- KRT19
Antibody
- Host Species
- Rb
- Clonality
- Polyclonal
Immunogen
- Immunogen
- A synthetic peptide corresponding to a sequence at the C-Terminus of human Cytokeratin 19 (334-372 aa QLAHIQALISGIEAQLGDVRADSERQNQEYQRLMDIKSR), different from the related mouse and rat sequences by nine amino acids.
- Immunogen Type
- SP-Lin
Format
- Conjugate/Label
- Unconj
- Format
- Lyophilized
- Formulation
- Lyophilized from 0.2mg Na2HPO4, 5mg BSA, 0.9mg NaCl, 0.05mg sodium azide.
- Preservative
- Yes
- Purification Method
- AP
Storage & Handling
- Storage Conditions
- At -20°C for 1 year. After reconstitution, at 4°C for 1 month. It can also be aliquotted and stored frozen at -20°C for a longer time. Avoid freeze-thaw cycles.
- Recommended Storage Buffer
- NaCl
