Polyclonal Rabbit anti-Human SLC5A11 / SMIT2 Antibody (WB)
Catalog Number: LS-C748223
2 sizes / from $281.00
Antibody: Rabbit Polyclonal
Applications: Immunohistochemistry (general), Western Blot
Reactivity: Human, Mouse, Rat
Format: Liquid
Kininogen 1 antibody Western blot. All lanes: Anti Kininogen 1 at 0.5 ug/ml. Lane 1: Mouse Lung Tissue Lysate at 50 ug. Lane 2: Mouse Testis Tissue Lysate at 50 ug. Lane 3: Mouse Liver Tissue Lysate at 50 ug. Lane 4: HEPA Whole Cell Lysate at 40 ug. Lane 5: NEURO Whole Cell Lysate at 40 ug. Predicted band size: 73 kD. Observed band size: 73 kD.
Polyclonal Rabbit anti-Mouse KNG1 / Kininogen / Bradykinin Antibody (aa227-259, IHC, WB)
Primary AntibodyLSBio Guarantee
| Antibody: | Rabbit Polyclonal |
| Applications: | Immunohistochemistry (general), Immunohistochemistry, Paraffin, Western Blot |
| Reactivity: | Mouse |
| Format: | Lyophilized |
$480.00each
Catalog Number: LS-C407867-100
Catalog Number: LS-C407867
For bulk orders or custom formulations:
Request a QuoteOverview
- Description
- Bradykinin antibody LS-C407867 is an unconjugated rabbit polyclonal antibody to mouse Bradykinin (KNG1 / Kininogen) (aa227-259). Validated for IHC and WB.
- Application
- IHC, IHC-P, WB
- Reactivity
- Ms
- Intended Use
- RUO
- Guarantees
- This antibody carries the LSBio 100% Guarantee. ✓
- Category
- Antibodies > Primary Antibodies > Polyclonal Antibodies
- Alternative Names
- Bradykinin | Flaujeac factor deficiency | Fitzgerald factor | Kininogen 1 | Kininogen-1 | Kininogen | BDK | HMWK | KNG | KNG1
- UniProt Number
- P01042
- NCBI GenBank
- NM_000893, NP_000884.1
- SwissProt
- P01042
Target
- Target
- Mouse KNG1 / Kininogen / Bradykinin
- Antigen Species
- Ms
- Epitope
- Plasma.
- Gene Name
- KNG1
Antibody
- Host Species
- Rb
- Clonality
- Polyclonal
Immunogen
- Immunogen
- A synthetic peptide corresponding to a sequence in the middle region of mouse Kininogen 1 (227-259 aa ECRGNLFMDINNKIANFSQSCTLYSGDDLVEA L), different from the related rat sequence by thirteen amino acids.
- Immunogen Type
- SP-Lin
Format
- Conjugate/Label
- Unconj
- Format
- Lyophilized
- Formulation
- Lyophilized from 0.2mg Na2HPO4, 5mg BSA, 0.9mg NaCl, 0.05mg sodium azide.
- Preservative
- Yes
- Purification Method
- AP
Storage & Handling
- Storage Conditions
- At -20°C for 1 year. After reconstitution, at 4°C for 1 month. It can also be aliquotted and stored frozen at -20°C for a longer time. Avoid freeze-thaw cycles.
- Recommended Storage Buffer
- NaCl
