Polyclonal Rabbit anti-Human SLC5A11 / SMIT2 Antibody (WB)
Catalog Number: LS-C748223
2 sizes / from $281.00
Antibody: Rabbit Polyclonal
Applications: Immunohistochemistry (general), Western Blot
Reactivity: Human, Mouse, Rat
Format: Liquid
IDO1 antibody Western blot. All lanes: Anti IDO1 at 0.5 ug/ml. Lane 1: Rat Lung Tissue Lysate at 50 ug. Lane 2: Rat Spleen Tissue Lysate at 50 ug. Lane 3: Human Placenta Tissue Lysate at 50 ug. Lane 4: A549 Whole Cell Lysate at 40 ug. Lane 5: SW620 Whole Cell Lysate at 40 ug. Lane 6: NIH3T3 Whole Cell Lysate at 40 ug. Predicted band size: 45 kD. Observed band size: 45 kD.
Polyclonal Rabbit anti-Human IDO1 / IDO Antibody (aa37-69, IHC, WB)
Primary AntibodyLSBio Guarantee
| Antibody: | Rabbit Polyclonal |
| Applications: | Immunohistochemistry (general), Immunohistochemistry, Paraffin, Western Blot |
| Reactivity: | Human |
| Format: | Lyophilized |
$480.00each
Catalog Number: LS-C407816-100
Catalog Number: LS-C407816
For bulk orders or custom formulations:
Request a QuoteOverview
- Description
- IDO antibody LS-C407816 is an unconjugated rabbit polyclonal antibody to human IDO (IDO1) (aa37-69). Validated for IHC and WB.
- Application
- IHC, IHC-P, WB
- Reactivity
- Hu
- Intended Use
- RUO
- Guarantees
- This antibody carries the LSBio 100% Guarantee. ✓
- Category
- Antibodies > Primary Antibodies > Polyclonal Antibodies
- Alternative Names
- IDO | Indole 2,3-dioxygenase | Indolamine 2,3 dioxygenase | IDO-1 | IDO1 | INDO | Indoleamine 2,3-dioxygenase | Indoleamine 2,3-dioxygenase 1
- UniProt Number
- P14902
- NCBI GenBank
- AAA36081.1, NM_002164
- SwissProt
- P14902
Target
- Target
- Human IDO1 / IDO
- Antigen Species
- Hu
- Gene Name
- IDO1
Antibody
- Host Species
- Rb
- Clonality
- Polyclonal
Immunogen
- Immunogen
- A synthetic peptide corresponding to a sequence at the N-Terminus of human IDO1 (37-69 aa NDWMFIAKHLPDLIESGQLRERVEKLNMLSIDH), different from the related mouse sequence by fourteen amino acids, and from the related rat sequence by seventeen amino acids.
- Immunogen Type
- SP-Lin
Format
- Conjugate/Label
- Unconj
- Format
- Lyophilized
- Formulation
- Lyophilized from 0.2mg Na2HPO4, 5mg BSA, 0.9mg NaCl, 0.05mg sodium azide.
- Preservative
- Yes
- Purification Method
- AP
Storage & Handling
- Storage Conditions
- At -20°C for 1 year. After reconstitution, at 4°C for 1 month. It can also be aliquotted and stored frozen at -20°C for a longer time. Avoid freeze-thaw cycles.
- Recommended Storage Buffer
- NaCl
