Polyclonal Rabbit anti-Human SLC5A11 / SMIT2 Antibody (WB)
Catalog Number: LS-C748223
2 sizes / from $281.00
Antibody: Rabbit Polyclonal
Applications: Immunohistochemistry (general), Western Blot
Reactivity: Human, Mouse, Rat
Format: Liquid
GRP78 BiP antibody Western blot. All lanes: Anti GRP78 BiP at 0.5 ug/ml. WB: HELA Whole Cell Lysate at 40 ug. Predicted band size: 80 kD. Observed band size: 80 kD.
Polyclonal Rabbit anti-Human HSPA5 / GRP78 / BiP Antibody (aa592-624, IHC, WB)
Primary AntibodyLSBio Guarantee
| Antibody: | Rabbit Polyclonal |
| Applications: | Immunohistochemistry (general), Immunohistochemistry, Paraffin, Western Blot |
| Reactivity: | Bovine, Dog, Goat, Hamster, Horse, Human, Mammal (Other), Mouse, Pig, Rabbit, Rat, Sheep |
| Format: | Lyophilized |
$480.00each
Catalog Number: LS-C407852-100
Catalog Number: LS-C407852
For bulk orders or custom formulations:
Request a QuoteOverview
- Description
- BiP antibody LS-C407852 is an unconjugated rabbit polyclonal antibody to BiP (HSPA5 / GRP78) (aa592-624) from human. It is reactive with human, mouse, rat and other species. Validated for IHC and WB.
- Application
- IHC, IHC-P, WB
- Reactivity
- Bov, Can, Gt, Ham, Hr, Hu, Mml, Ms, Por, Rb, Rt, Sh
- Intended Use
- RUO
- Guarantees
- This antibody carries the LSBio 100% Guarantee. ✓
- Category
- Antibodies > Primary Antibodies > Polyclonal Antibodies
- Alternative Names
- BIP | Heat shock 70 kDa protein 5 | MIF2 | GRP-78 | GRP78 | HSPA5
- UniProt Number
- P11021
- NCBI GenBank
- AAA52614.1, M19645
- SwissProt
- P11021
Target
- Target
- Human HSPA5 / GRP78 / BiP
- Antigen Species
- Hu
- Gene Name
- HSPA5
Antibody
- Host Species
- Rb
- Clonality
- Polyclonal
Immunogen
- Immunogen
- A synthetic peptide corresponding to a sequence at the C-Terminus of human GRP78 BiP (592-624 aa ETMEKAVEEKIEWLESHQDADIEDFKAKKKELE), identical to the related mouse and rat sequences.
- Immunogen Type
- SP-Lin
Format
- Conjugate/Label
- Unconj
- Format
- Lyophilized
- Formulation
- Lyophilized from 0.2mg Na2HPO4, 5mg BSA, 0.9mg NaCl, 0.05mg sodium azide.
- Preservative
- Yes
- Purification Method
- AP
Storage & Handling
- Storage Conditions
- At -20°C for 1 year. After reconstitution, at 4°C for 1 month. It can also be aliquotted and stored frozen at -20°C for a longer time. Avoid freeze-thaw cycles.
- Recommended Storage Buffer
- NaCl
