Human Apolipoprotein H Antibody (IgA) ELISA Kit (Sandwich ELISA)
Catalog Number: LS-F67373-1
1 plate / $591.00
Reactivity: Human
Detection Method Colorimetric
Format: 96-Well Strip Plate
Hsp70 antibody Western blot. All lanes: Anti Hsp70 at 0.5 ug/ml. Lane 1: Rat Liver Tissue Lysate at 50 ug. Lane 2: Rat Thymus Tissue Lysate at 50 ug. Lane 3: Mouse Liver Tissue Lysate at 50 ug. Lane 4: Mouse Kidney Tissue Lysate at 50 ug. Lane 5: HELA Whole Cell Lysate at 40 ug. Lane 6: MCF-7 Whole Cell Lysate at 40 ug. Predicted band size: 70 kD. Observed band size: 70 kD.
HSPA1A Antibody (aa559-596)
Primary AntibodyLSBio Guarantee
| Antibody: | Rabbit Polyclonal |
| Applications: | Immunohistochemistry (general), Immunohistochemistry, Paraffin, Western Blot |
| Reactivity: | Bovine, Dog, Horse, Human, Mouse, Pig, Rat, Sheep |
| Format: | Lyophilized |
$480.00each
Catalog Number: LS-C407850-100
Catalog Number: LS-C407850
For bulk orders or custom formulations:
Request a QuoteOverview
- Description
- HSPA1A antibody LS-C407850 is an unconjugated rabbit polyclonal antibody to HSPA1A (aa559-596) from human. It is reactive with human, mouse, rat and other species. Validated for IHC and WB.
- Application
- IHC, IHC-P, WB
- Reactivity
- Bov, Can, Hr, Hu, Ms, Por, Rt, Sh
- Intended Use
- Research Use Only
- Guarantees
- This antibody carries the LSBio 100% Guarantee. ✓
- Category
- Antibodies > Primary Antibodies > Polyclonal Antibodies
- Alternative Names
- Heat shock 70kDa protein 1A | Heat shock 70 kDa protein 1/2 | Heat shock 70kD protein 1A | HSP70-1/HSP70-2 | HSPA1 | HSP70-1A | Heat shock 70 kd protein 1 | Heat shock-induced protein | Iroquois homeobox protein 4 | HSP70-1 | Hsp70.1 | HSP70.1/HSP70.2 | HSP70I | HSP72 | HSPA1A
- NCBI GenBank
- NM_005345 | NP_005336.3
Target
- Target
- Human HSPA1A
- Antigen Species
- Human
Antibody
- Host Species
- Rabbit
- Clonality
- Polyclonal
Immunogen
- Immunogen
- A synthetic peptide corresponding to a sequence at the C-Terminus of human Hsp70 (559-596 aa KGKISEADKKKVLDKCQEVISWLDANTLAEKDEFEHKR), different from the related mouse sequence by five amino acids, and from the related rat sequence by three amino acids.
- Immunogen Type
- Synthetic Peptide (Linear)
Format
- Conjugate/Label
- Unconjugated
- Format
- Lyophilized
- Formulation
- Lyophilized from 0.2mg Na2HPO4, 5mg BSA, 0.9mg NaCl, 0.05mg sodium azide.
- Preservative
- Yes
- Purification Method
- Affinity Purified
Storage & Handling
- Storage Conditions
- At -20°C for 1 year. After reconstitution, at 4°C for 1 month. It can also be aliquotted and stored frozen at -20°C for a longer time. Avoid freeze-thaw cycles.
- Recommended Storage Buffer
- NaCl
