Hsp90 beta antibody Western blot. All lanes: Anti Hsp90 beta at 0.5 ug/ml. Lane 1: Rat Testis Tissue Lysate at 50 ug. Lane 2: Rat Thymus Tissue Lysate at 50 ug. Lane 3: Human Placenta Tissue Lysate at 50 ug. Lane 4: SW620 Whole Cell Lysate at 40 ug. Lane 5: HELA Whole Cell Lysate at 40 ug. Predicted band size: 90 kD. Observed band size: 90 kD.
HSP90AB1 / HSP90 Alpha B1 Antibody (aa449-481)
Primary AntibodyLSBio Guarantee
| Antibody: | Rabbit Polyclonal |
| Applications: | Immunohistochemistry (general), Immunohistochemistry, Paraffin, Western Blot |
| Reactivity: | Bovine, Dog, Guinea Pig, Hamster, Horse, Human, Mammal (Other), Mouse, Pig, Rabbit, Rat, Sheep |
| Format: | Lyophilized |
$480.00each
Catalog Number: LS-C407848-100
Catalog Number: LS-C407848
For bulk orders or custom formulations:
Request a QuoteOverview
- Description
- HSP90 Alpha B1 antibody LS-C407848 is an unconjugated rabbit polyclonal antibody to HSP90 Alpha B1 (HSP90AB1) (aa449-481) from human. It is reactive with human, mouse, rat and other species. Validated for IHC and WB.
- Application
- IHC, IHC-P, WB
- Reactivity
- Bov, Can, GP, Ham, Hr, Hu, Mml, Ms, Por, Rb, Rt, Sh
- Intended Use
- RUO
- Guarantees
- This antibody carries the LSBio 100% Guarantee. ✓
- Category
- Antibodies > Primary Antibodies > Polyclonal Antibodies
- Alternative Names
- D6S182 | Heat shock 84 kDa | Heat shock protein beta | Heat shock protein HSP 90-beta | HSP 84 | HSP84 | HSP 90 | HSP90AB1 | HSP90-BETA | HSP90B | HSPC2 | HSPCB
- UniProt Number
- P08238
- NCBI GenBank
- NM_007355, NP_031381.2
- SwissProt
- P08238
Target
- Target
- Human HSP90AB1 / HSP90 Alpha B1
- Antigen Species
- Hu
- Gene Name
- HSP90AB1
Antibody
- Host Species
- Rb
- Clonality
- Polyclonal
Immunogen
- Immunogen
- A synthetic peptide corresponding to a sequence at the C-Terminus of human Hsp90 beta (449-481 aa RRLSELLRYHTSQSGDEMTSLSEYVSRMKETQK), identical to the related mouse and rat sequences.
- Immunogen Type
- SP-Lin
Format
- Conjugate/Label
- Unconj
- Format
- Lyophilized
- Formulation
- Lyophilized from 0.2mg Na2HPO4, 5mg BSA, 0.9mg NaCl, 0.05mg sodium azide.
- Preservative
- Yes
- Purification Method
- AP
Storage & Handling
- Storage Conditions
- At -20°C for 1 year. After reconstitution, at 4°C for 1 month. It can also be aliquotted and stored frozen at -20°C for a longer time. Avoid freeze-thaw cycles.
- Recommended Storage Buffer
- NaCl