HIF 1 alpha antibody Western blot. All lanes: Anti HIF 1 alpha at 0.5 ug/ml. WB: Recombinant Human HIF 1 alpha Protein 0.5ng. Predicted band size: 36 kD. Observed band size: 36 kD.
HIF1A / HIF1 Alpha Antibody (aa703-732)
Primary AntibodyLSBio Guarantee
| Antibody: | Rabbit Polyclonal |
| Applications: | Immunohistochemistry (general), Immunohistochemistry, Paraffin, Western Blot |
| Reactivity: | Human, Mouse, Non-Human Primate, Rat |
| Format: | Lyophilized |
$480.00each
Catalog Number: LS-C357423-100
Catalog Number: LS-C357423
For bulk orders or custom formulations:
Request a QuoteOverview
- Description
- HIF1 Alpha antibody LS-C357423 is an unconjugated rabbit polyclonal antibody to HIF1 Alpha (HIF1A) (aa703-732) from human. It is reactive with human, mouse, rat and other species. Validated for IHC and WB.
- Application
- IHC, IHC-P, WB
- Reactivity
- Hu, Ms, NHP, Rt
- Intended Use
- RUO
- Guarantees
- This antibody carries the LSBio 100% Guarantee. ✓
- Category
- Antibodies > Primary Antibodies > Polyclonal Antibodies
- Alternative Names
- ARNT-interacting protein | ARNT interacting protein | BHLHe78 | HIF1 Alpha | HIF1A | Hypoxia-inducible factor1alpha | HIF-1A | HIF1 | MOP1 | Member of PAS superfamily 1 | PASD8 | HIF-1-alpha | HIF-1alpha | HIF1-ALPHA | Member of PAS protein 1
- UniProt Number
- Q16665
- NCBI GenBank
- NM_001530, NP_001521.1
- SwissProt
- Q16665
Target
- Target
- Human HIF1A / HIF1 Alpha
- Antigen Species
- Hu
- Epitope
- Expressed in most tissues with highest levels in kidney and heart. Overexpressed in the majority of common human cancers and their metastases, due to the presence of intratumoral hypoxia and as a result of mutations in genes encoding oncoproteins and tumor suppressors. A higher level expression seen in pituitary tumors as compared to the pituitary gland. .
- Gene Name
- HIF1A
Antibody
- Host Species
- Rb
- Clonality
- Polyclonal
Immunogen
- Immunogen
- A synthetic peptide corresponding to a sequence at the C-Terminus of human HIF-1-alpha (703-732 aa EEELNPKILALQNAQRKRKMEHDGSLFQAV), different from the related mouse and rat sequences by three amino acids.
- Immunogen Type
- SP-Lin
Format
- Conjugate/Label
- Unconj
- Format
- Lyophilized
- Formulation
- Lyophilized from 0.2mg Na2HPO4, 5mg BSA, 0.9mg NaCl, 0.05mg sodium azide.
- Concentration
- 0.5 mg/mL
- Preservative
- Yes
- Purification Method
- AP
Storage & Handling
- Storage Conditions
- At -20°C for 1 year. After reconstitution, at 4°C for 1 month. It can also be aliquotted and stored frozen at -20°C for a longer time. Avoid freeze-thaw cycles.
- Recommended Storage Buffer
- NaCl