Fascin antibody Western blot. All lanes: Anti Fascin at 0.5 ug/ml. Lane 1: Rat Brain Tissue Lysate at 50 ug. Lane 2: Rat Lung Tissue Lysate at 50 ug. Lane 3: HELA Whole Cell Lysate at 40 ug. Lane 4: SKOV Whole Cell Lysate at 40 ug. Predicted band size: 55 kD. Observed band size: 55 kD.
FSCN1 / Fascin Antibody (aa42-73)
Primary AntibodyLSBio Guarantee
| Antibody: | Rabbit Polyclonal |
| Applications: | Western Blot |
| Reactivity: | Bovine, Dog, Guinea Pig, Hamster, Horse, Human, Mouse, Rat, Sheep |
| Format: | Lyophilized |
$480.00each
Catalog Number: LS-C407805-100
Catalog Number: LS-C407805
For bulk orders or custom formulations:
Request a QuoteOverview
- Description
- Fascin antibody LS-C407805 is an unconjugated rabbit polyclonal antibody to Fascin (FSCN1) (aa42-73) from human. It is reactive with human, mouse, rat and other species. Validated for WB.
- Application
- WB
- Reactivity
- Bov, Can, GP, Ham, Hr, Hu, Ms, Rt, Sh
- Intended Use
- RUO
- Guarantees
- This antibody carries the LSBio 100% Guarantee. ✓
- Category
- Antibodies > Primary Antibodies > Polyclonal Antibodies
- Alternative Names
- 55 kDa actin-bundling protein | FSCN1 | Fascin | HSN | Singed-like protein | SNL | p55
- UniProt Number
- Q16658
- NCBI GenBank
- NM_003088, NP_003079.1
- SwissProt
- Q16658
Target
- Target
- Human FSCN1 / Fascin
- Antigen Species
- Hu
- Epitope
- Ubiquitous.
- Gene Name
- FSCN1
Antibody
- Host Species
- Rb
- Clonality
- Polyclonal
Immunogen
- Immunogen
- A synthetic peptide corresponding to a sequence at the N-Terminus of human Fascin (42-73 aa KKQIWTLEQPPDEAGSAAVCLRSHLGRYLAAD), identical to the related mouse sequence, and different from the related rat sequence by one amino acid.
- Immunogen Type
- SP-Lin
Format
- Conjugate/Label
- Unconj
- Format
- Lyophilized
- Formulation
- Lyophilized from 0.2mg Na2HPO4, 5mg BSA, 0.9mg NaCl, 0.05mg sodium azide.
- Preservative
- Yes
- Purification Method
- AP
Storage & Handling
- Storage Conditions
- At -20°C for 1 year. After reconstitution, at 4°C for 1 month. It can also be aliquotted and stored frozen at -20°C for a longer time. Avoid freeze-thaw cycles.
- Recommended Storage Buffer
- NaCl