Polyclonal Rabbit anti-Human SLC5A11 / SMIT2 Antibody (WB)
Catalog Number: LS-C748223
2 sizes / from $281.00
Antibody: Rabbit Polyclonal
Applications: Immunohistochemistry (general), Western Blot
Reactivity: Human, Mouse, Rat
Format: Liquid
FABP4 antibody Western blot. All lanes: Anti FABP4 at 0.5 ug/ml. Lane 1: Rat Thymus Tissue Lysate at 50 ug. Lane 2: Rat Cardiac Muscle Tissue Lysate at 50 ug. Lane 3: Mouse Thymus Tissue Lysate at 50 ug. Lane 4: Mouse Cardiac Muscle Tissue Lysate at 50 ug. Predicted band size: 15 kD. Observed band size: 15 kD.
Polyclonal Rabbit anti-Human FABP4 / AP2 Antibody (aa10-40, IHC, WB)
Primary AntibodyLSBio Guarantee
| Antibody: | Rabbit Polyclonal |
| Applications: | Immunohistochemistry (general), Immunohistochemistry, Paraffin, Western Blot |
| Reactivity: | Hamster, Human, Mouse, Rat |
| Format: | Lyophilized |
$480.00each
Catalog Number: LS-C408140-100
Catalog Number: LS-C408140
For bulk orders or custom formulations:
Request a QuoteOverview
- Description
- AP2 antibody LS-C408140 is an unconjugated rabbit polyclonal antibody to AP2 (FABP4) (aa10-40) from human. It is reactive with human, mouse, rat and other species. Validated for IHC and WB.
- Application
- IHC, IHC-P, WB
- Reactivity
- Ham, Hu, Ms, Rt
- Intended Use
- RUO
- Guarantees
- This antibody carries the LSBio 100% Guarantee. ✓
- Category
- Antibodies > Primary Antibodies > Polyclonal Antibodies
- Alternative Names
- A-FABP | AFABP | ALBP | AP2 | FABP4 | Fatty acid-binding protein 4
- UniProt Number
- P15090
- NCBI GenBank
- NM_001442, NP_001433.1
- SwissProt
- P15090
Target
- Target
- Human FABP4 / AP2
- Antigen Species
- Hu
- Gene Name
- FABP4
Antibody
- Host Species
- Rb
- Clonality
- Polyclonal
Immunogen
- Immunogen
- A synthetic peptide corresponding to a sequence at the N-Terminus of human FABP4 (10-40 aa KLVSSENFDDYMKEVGVGFATRKVAGMAKPN), identical to the related mouse and rat sequences.
- Immunogen Type
- SP-Lin
Format
- Conjugate/Label
- Unconj
- Format
- Lyophilized
- Formulation
- Lyophilized from 0.2mg Na2HPO4, 5mg BSA, 0.9mg NaCl, 0.05mg sodium azide.
- Preservative
- Yes
- Purification Method
- AP
Storage & Handling
- Storage Conditions
- At -20°C for 1 year. After reconstitution, at 4°C for 1 month. It can also be aliquotted and stored frozen at -20°C for a longer time. Avoid freeze-thaw cycles.
- Recommended Storage Buffer
- NaCl
