Polyclonal Rabbit anti-Human SLC5A11 / SMIT2 Antibody (WB)
Catalog Number: LS-C748223
2 sizes / from $281.00
Antibody: Rabbit Polyclonal
Applications: Immunohistochemistry (general), Western Blot
Reactivity: Human, Mouse, Rat
Format: Liquid
PAR2 antibody Western blot. All lanes: Anti PAR2 at 0.5 ug/ml. Lane 1: HELA Whole Cell Lysate at 40 ug. Lane 2: COLO320 Whole Cell Lysate at 40 ug. Lane 3: SW620 Whole Cell Lysate at 40 ug. Lane 4: HEPG2 Whole Cell Lysate at 40 ug. Predicted band size: 49 kD. Observed band size: 49 kD.
Polyclonal Rabbit anti-Human F2RL1 / PAR2 Antibody (aa349-383, WB)
Primary AntibodyLSBio Guarantee
| Antibody: | Rabbit Polyclonal |
| Applications: | Western Blot |
| Reactivity: | Human |
| Format: | Lyophilized |
$480.00each
Catalog Number: LS-C407912-100
Catalog Number: LS-C407912
For bulk orders or custom formulations:
Request a QuoteOverview
- Description
- PAR2 antibody LS-C407912 is an unconjugated rabbit polyclonal antibody to human PAR2 (F2RL1) (aa349-383). Validated for WB.
- Application
- WB
- Reactivity
- Hu
- Intended Use
- RUO
- Guarantees
- This antibody carries the LSBio 100% Guarantee. ✓
- Category
- Antibodies > Primary Antibodies > Polyclonal Antibodies
- Alternative Names
- F2RL1 | PAR2 | Thrombin receptor-like 1 | Protease-activated receptor 2 | G-protein coupled receptor 11 | GPR11 | PAR-2
- UniProt Number
- P55085
- NCBI GenBank
- NM_005242, NP_005233.3
- SwissProt
- P55085
Target
- Target
- Human F2RL1 / PAR2
- Antigen Species
- Hu
- Epitope
- Widely expressed in tissues with especially high levels in pancreas, liver, kidney, small intestine, and colon. Moderate expression is detected in many organs, but none in brain or skeletal muscle.
- Gene Name
- F2RL1
Antibody
- Host Species
- Rb
- Clonality
- Polyclonal
Immunogen
- Immunogen
- A synthetic peptide corresponding to a sequence at the C-Terminus of human PAR2 (349-383 aa HDFRDHAKNALLCRSVRTVKQMQVSLTSKKHSRKS), different from the related mouse sequence by eight amino acids, and from the related rat sequence by seven amino acids.
- Immunogen Type
- SP-Lin
Format
- Conjugate/Label
- Unconj
- Format
- Lyophilized
- Formulation
- Lyophilized from 0.2mg Na2HPO4, 5mg BSA, 0.9mg NaCl, 0.05mg sodium azide.
- Preservative
- Yes
- Purification Method
- AP
Storage & Handling
- Storage Conditions
- At -20°C for 1 year. After reconstitution, at 4°C for 1 month. It can also be aliquotted and stored frozen at -20°C for a longer time. Avoid freeze-thaw cycles.
- Recommended Storage Buffer
- NaCl
