Polyclonal Rabbit anti-Human SLC5A11 / SMIT2 Antibody (WB)
Catalog Number: LS-C748223
2 sizes / from $281.00
Antibody: Rabbit Polyclonal
Applications: Immunohistochemistry (general), Western Blot
Reactivity: Human, Mouse, Rat
Format: Liquid
Thrombin Receptor antibody Western blot. All lanes: Anti Thrombin Receptor at 0.5 ug/ml. Lane 1: MCF-7 Whole Cell Lysate at 40 ug. Lane 2: HELA Whole Cell Lysate at 40 ug. Lane 3: 22RV1 Whole Cell Lysate at 40 ug. Lane 4: SW620 Whole Cell Lysate at 40 ug. Predicted band size: 47 kD. Observed band size: 47 kD.
Polyclonal Rabbit anti-Human F2R / Thrombin Receptor / PAR1 Antibody (aa46-82, IHC, WB)
Primary AntibodyLSBio Guarantee
| Antibody: | Rabbit Polyclonal |
| Applications: | Immunohistochemistry (general), Immunohistochemistry, Paraffin, Western Blot |
| Reactivity: | Human |
| Format: | Lyophilized |
$480.00each
Catalog Number: LS-C408146-100
Catalog Number: LS-C408146
For bulk orders or custom formulations:
Request a QuoteOverview
- Description
- PAR1 antibody LS-C408146 is an unconjugated rabbit polyclonal antibody to human PAR1 (F2R / Thrombin Receptor) (aa46-82). Validated for IHC and WB.
- Application
- IHC, IHC-P, WB
- Reactivity
- Hu
- Intended Use
- Research Use Only
- Guarantees
- This antibody carries the LSBio 100% Guarantee. ✓
- Category
- Antibodies > Primary Antibodies > Polyclonal Antibodies
- Alternative Names
- CF2R | Coagulation factor II receptor | F2R | PAR1 | PAR-1 | Thrombin receptor | TR | HTR | Protease-activated receptor 1
- UniProt Number
- P25116
- NCBI GenBank
- NM_001992 | NP_001983.2
- SwissProt
- P25116
Target
- Target
- Human F2R / Thrombin Receptor / PAR1
- Antigen Species
- Human
- Epitope
- Platelets and vascular endothelial cells.
- Gene Name
- F2R
Antibody
- Host Species
- Rabbit
- Clonality
- Polyclonal
Immunogen
- Immunogen
- A synthetic peptide corresponding to a sequence at the N-Terminus of human Thrombin Receptor (46-82 aa RNPNDKYEPFWEDEEKNESGLTEYRLVSINKSSPLQK).
- Immunogen Type
- Synthetic Peptide (Linear)
Format
- Conjugate/Label
- Unconjugated
- Format
- Lyophilized
- Formulation
- Lyophilized from 0.2mg Na2HPO4, 5mg BSA, 0.9mg NaCl, 0.05mg sodium azide.
- Preservative
- Yes
- Purification Method
- Affinity Purified
Storage & Handling
- Storage Conditions
- At -20°C for 1 year. After reconstitution, at 4°C for 1 month. It can also be aliquotted and stored frozen at -20°C for a longer time. Avoid freeze-thaw cycles.
- Recommended Storage Buffer
- NaCl
