ELAVL4 antibody Western blot. All lanes: Anti ELAVL4 at 0.5 ug/ml. Lane 1: Rat Brain Tissue Lysate at 50 ug. Lane 2: Mouse Brain Tissue Lysate at 50 ug. Lane 3: U87 Whole Cell Lysate at 40 ug. Predicted band size: 42 kD. Observed band size: 42 kD.

ELAVL4 / HuD Antibody (aa8-45)

Primary AntibodyLSBio Guarantee

Antibody:	Rabbit Polyclonal
Applications:	Immunohistochemistry (general), Immunohistochemistry, Paraffin, Western Blot
Reactivity:	Human, Mouse, Rat
Format:	Lyophilized

$480.00each

Catalog Number: LS-C407910-100

Unit Size

Quantity

For bulk orders or custom formulations:

Overview

Description: HuD antibody LS-C407910 is an unconjugated rabbit polyclonal antibody to HuD (ELAVL4) (aa8-45) from human. It is reactive with human, mouse and rat. Validated for IHC and WB.
Application: IHC, IHC-P, WB
Reactivity: Hu, Ms, Rt
Intended Use: RUO
Guarantees: This antibody carries the LSBio 100% Guarantee. ✓
Category: Antibodies > Primary Antibodies > Polyclonal Antibodies
Alternative Names: ELAV-like protein 4 | ELAVL4 | Hu antigen D | HUD | PNEM | Hu-antigen D
UniProt Number: P26378
NCBI GenBank: NM_021952, NP_068771.2
SwissProt: P26378

Target

Target: Human ELAVL4 / HuD
Antigen Species: Hu
Epitope: Brain.
Gene Name: ELAVL4

Antibody

Host Species: Rb
Clonality: Polyclonal

Immunogen

Immunogen: A synthetic peptide corresponding to a sequence at the N-Terminus of human ELAVL4 (8-45 aa MEPQVSNGPTSNTSNGPSSNNRNCPSPMQTGATTDDSK), different from the related mouse and rat sequences by one amino acid.
Immunogen Type: SP-Lin

Format

Conjugate/Label: Unconj
Format: Lyophilized
Formulation: Lyophilized from 0.2mg Na2HPO4, 5mg BSA, 0.9mg NaCl, 0.05mg sodium azide.
Preservative: Yes
Purification Method: AP

Storage & Handling

Storage Conditions: At -20°C for 1 year. After reconstitution, at 4°C for 1 month. It can also be aliquotted and stored frozen at -20°C for a longer time. Avoid freeze-thaw cycles.
Recommended Storage Buffer: NaCl