Polyclonal Rabbit anti-Human SLC5A11 / SMIT2 Antibody (WB)
Catalog Number: LS-C748223
2 sizes / from $281.00
Antibody: Rabbit Polyclonal
Applications: Immunohistochemistry (general), Western Blot
Reactivity: Human, Mouse, Rat
Format: Liquid
Polyclonal Rabbit anti-Human CXCL9 / MIG Antibody (WB)
Primary AntibodyLSBio Guarantee
| Antibody: | Rabbit Polyclonal |
| Applications: | Immunohistochemistry (general), Western Blot |
| Reactivity: | Human |
| Format: | Liquid |
$281.00each
Catalog Number: LS-C408364-20
Catalog Number: LS-C408364
For bulk orders or custom formulations:
Request a QuoteOverview
- Description
- MIG antibody LS-C408364 is an unconjugated rabbit polyclonal antibody to human MIG (CXCL9). Validated for WB.
- Application
- IHC, WB
- Reactivity
- Hu
- Intended Use
- RUO
- Guarantees
- This antibody carries the LSBio 100% Guarantee. ✓
- Category
- Antibodies > Primary Antibodies > Polyclonal Antibodies
- Alternative Names
- Crg-10 | CXCL9 | Humig | SCYB9 | Small-inducible cytokine B9 | C-X-C motif chemokine 9 | CMK | MIG
- Recommended Dilution: WB
- 1:500 - 1:2000
- UniProt Number
- Q07325
- NCBI GenBank
- NM_002416, NP_002407.1
- SwissProt
- Q07325
Target
- Target
- Human CXCL9 / MIG
- Antigen Species
- Hu
- Epitope
- Human CXCL9 / MIG
- Gene Name
- CXCL9
Antibody
- Host Species
- Rb
- Clonality
- Polyclonal
- Isotype
- IgG
Immunogen
- Immunogen
- A synthetic peptide corresponding to a sequence within amino acids 50 to the C-Terminus of human CXCL9 (NP_002407.1). KQFAPSPSCEKIEIIATLKNGVQTCLNPDSADVKELIKKWEKQVSQKKKQKNGKKHQKKKVLKVRKSQRSRQKKTT
- Immunogen Type
- SP-Lin
Format
- Conjugate/Label
- Unconj
- Format
- Liquid
- Formulation
- PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
- Volume
- 20 Microliter
- Preservative
- Yes
- Purification Method
- AP
Storage & Handling
- Storage Conditions
- Store at -20°C. Avoid freeze-thaw cycles.
- Recommended Storage Buffer
- PBS
