Polyclonal Rabbit anti-Human SLC5A11 / SMIT2 Antibody (WB)
Catalog Number: LS-C748223
2 sizes / from $281.00
Antibody: Rabbit Polyclonal
Applications: Immunohistochemistry (general), Western Blot
Reactivity: Human, Mouse, Rat
Format: Liquid
Cryptochrome I antibody Western blot. All lanes: Anti Cryptochrome I at 0.5 ug/ml. Lane 1: Rat Brain Tissue Lysate at 50 ug. Lane 2: Rat Testis Tissue Lysate at 50 ug. Lane 3: HELA Whole Cell Lysate at 40 ug. Predicted band size: 66 kD. Observed band size: 66 kD.
Polyclonal Rabbit anti-Human CRY1 Antibody (aa153-189, WB)
Primary AntibodyLSBio Guarantee
| Antibody: | Rabbit Polyclonal |
| Applications: | Western Blot |
| Reactivity: | Bovine, Horse, Human, Pig, Rat, Sheep |
| Format: | Lyophilized |
$480.00each
Catalog Number: LS-C407753-100
Catalog Number: LS-C407753
For bulk orders or custom formulations:
Request a QuoteOverview
- Description
- CRY1 antibody LS-C407753 is an unconjugated rabbit polyclonal antibody to CRY1 (aa153-189) from human. It is reactive with human, rat, bovine and other species. Validated for WB.
- Application
- WB
- Reactivity
- Bov, Hr, Hu, Por, Rt, Sh
- Intended Use
- RUO
- Guarantees
- This antibody carries the LSBio 100% Guarantee. ✓
- Category
- Antibodies > Primary Antibodies > Polyclonal Antibodies
- Alternative Names
- Chryptochrome 1 | Cryptochrome-1 | Photolyase homolog 1 | CRY1 | PHLL1
- UniProt Number
- Q16526
- NCBI GenBank
- NM_004075, NP_004066.1
- SwissProt
- Q16526
Target
- Target
- Human CRY1
- Antigen Species
- Hu
- Gene Name
- CRY1
Antibody
- Host Species
- Rb
- Clonality
- Polyclonal
Immunogen
- Immunogen
- A synthetic peptide corresponding to a sequence at the N-Terminus of human Cryptochrome I (153-189 aa FQTLISKMEPLEIPVETITSEVIEKCTTPLSDDHDEK), different from the related mouse sequence by seven amino acids, and from the related rat sequence by six amino aci
- Immunogen Type
- SP-Lin
Format
- Conjugate/Label
- Unconj
- Format
- Lyophilized
- Formulation
- Lyophilized from 0.2mg Na2HPO4, 5mg BSA, 0.9mg NaCl, 0.05mg sodium azide.
- Preservative
- Yes
- Purification Method
- AP
Storage & Handling
- Storage Conditions
- At -20°C for 1 year. After reconstitution, at 4°C for 1 month. It can also be aliquotted and stored frozen at -20°C for a longer time. Avoid freeze-thaw cycles.
- Recommended Storage Buffer
- NaCl
