Western blot testing of human 1) HeLa, 2) U-87 MG, 3) A431, 4) K562, 5) A549, 6) Caco-2, 7) rat stomach and 8) mouse stomach lysate with CHM antibody at 0.5ug/ml. Predicted molecular weight ~73 kDa.

CHM / REP1 Antibody

Primary AntibodyLSBio Guarantee

Antibody:	Rabbit Polyclonal
Applications:	Flow Cytometry, Immunofluorescence, Immunohistochemistry, Paraffin, Western Blot
Reactivity:	Human, Mouse, Rat
Format:	Lyophilized

$587.00each

Catalog Number: LS-C782869-100

Unit Size

Quantity

For bulk orders or custom formulations:

Overview

Description: REP1 antibody LS-C782869 is an unconjugated rabbit polyclonal antibody to REP1 (CHM) from human. It is reactive with human, mouse and rat. Validated for Flow, IF, IHC and WB.
Application: FC, IF, IHC-P, WB
Reactivity: Hu, Ms, Rt
Intended Use: RUO
Guarantees: This antibody carries the LSBio 100% Guarantee. ✓
Category: Antibodies > Primary Antibodies > Polyclonal Antibodies
Alternative Names: Choroideraemia protein | CHM | DXS540 | GGTA | HSD-32 | REP-1 | REP1 | Rab escort protein 1 | TCD | TCD protein
Recommended Dilution: FC: 1 - 3 µg/10E6 cells
Recommended Dilution: IF/ICC: 2 - 4 µg/ml
Recommended Dilution: IHC-P: 1 - 2 µg/ml
Recommended Dilution: WB: 0.5 - 1 µg/ml
UniProt Number: P24386
NCBI GenBank: NM_000390, NP_000381.1
SwissProt: P24386

Target

Target: Human CHM / REP1
Antigen Species: Hu
Gene Name: CHM

Antibody

Host Species: Rb
Clonality: Polyclonal
Isotype: IgG
Origin Species: Hu

Immunogen

Immunogen: Amino acids QDQILENEEAIALSRKDKTIQHVEVFCYASQDLHED from the human protein were used as the immunogen for the CHM antibody.

Format

Conjugate/Label: Unconj
Format: Lyophilized
Formulation: Lyophilized from PBS, 2% Trehalose, 0.025% sodium azide
Preservative: Yes
Purification Method: AP

Storage & Handling

Storage Conditions: After reconstitution, store at 4°C for up to 1 month. Long-term: aliquot and store at -20°C. Avoid freeze-thaws cycles.
Recommended Storage Buffer: PBS