Human Apolipoprotein H Antibody (IgA) ELISA Kit (Sandwich ELISA)
Catalog Number: LS-F67373-1
1 plate / $591.00
Reactivity: Human
Detection Method Colorimetric
Format: 96-Well Strip Plate
CD36 antibody Western blot. All lanes: Anti CD36 at 0.5 ug/ml. Lane 1: Rat Liver Tissue Lysate at 50 ug. Lane 2: Rat Cardiac Muscle Tissue Lysate at 50 ug. Lane 3: Mouse Liver Tissue Lysate at 50 ug. Lane 4: Mouse Cardiac Muscle Tissue Lysate at 50 ug. Lane 5: SMMC Whole Cell Lysate at 40 ug. Predicted band size: 53 kD. Observed band size: 88 kD.
CD36 Antibody (aa31-66)
Primary AntibodyLSBio Guarantee
| Antibody: | Rabbit Polyclonal |
| Applications: | Immunohistochemistry (general), Immunohistochemistry, Paraffin, Western Blot |
| Reactivity: | Human, Mouse, Rat |
| Format: | Lyophilized |
$480.00each
Catalog Number: LS-C357564-100
Catalog Number: LS-C357564
For bulk orders or custom formulations:
Request a QuoteOverview
- Description
- CD36 antibody LS-C357564 is an unconjugated rabbit polyclonal antibody to CD36 (aa31-66) from human. It is reactive with human, mouse and rat. Validated for IHC and WB.
- Application
- IHC, IHC-P, WB
- Reactivity
- Hu, Ms, Rt
- Intended Use
- RUO
- Guarantees
- This antibody carries the LSBio 100% Guarantee. ✓
- Category
- Antibodies > Primary Antibodies > Polyclonal Antibodies
- Alternative Names
- Cluster determinant 36 | FAT | Fatty acid translocase | Glycoprotein IIIb | gp4 | GPIIIB | GPIV | PAS-4 protein | PAS IV | PASIV | Platelet collagen receptor | Platelet glycoprotein IV | SCARB3 | Thrombospondin receptor | BDPLT10 | CD36 | CD36 antigen | CHDS7 | gp3B | PAS-4 | Platelet glycoprotein 4
- UniProt Number
- P16671
- NCBI GenBank
- NM_000072, NP_000063.2
- SwissProt
- P16671
Target
- Target
- Human CD36
- Antigen Species
- Hu
- Gene Name
- CD36
Antibody
- Host Species
- Rb
- Clonality
- Polyclonal
Immunogen
- Immunogen
- A synthetic peptide corresponding to a sequence at the N-Terminus of human CD36 (31-66 aa DLLIQKTIKKQVVLEEGTIAFKNWVKTGTEVYRQFW), different from the related mouse sequence by six amino acids, and from the related rat sequence by four amino acids.
- Immunogen Type
- SP-Lin
Format
- Conjugate/Label
- Unconj
- Format
- Lyophilized
- Formulation
- Lyophilized from 0.2mg Na2HPO4, 5mg BSA, 0.9mg NaCl, 0.05mg sodium azide.
- Concentration
- 0.5 mg/mL
- Preservative
- Yes
- Purification Method
- AP
Storage & Handling
- Storage Conditions
- At -20°C for 1 year. After reconstitution, at 4°C for 1 month. It can also be aliquotted and stored frozen at -20°C for a longer time. Avoid freeze-thaw cycles.
- Recommended Storage Buffer
- NaCl
