
CCL5 / RANTES Antibody
Primary AntibodyLSBio Guarantee
| Antibody: | Rabbit Polyclonal |
| Applications: | Western Blot |
| Reactivity: | Human, Mouse, Rat |
| Format: | Liquid |
$281.00each
Catalog Number: LS-C749203-20
Catalog Number: LS-C749203
For bulk orders or custom formulations:
Request a QuoteOverview
- Description
- RANTES antibody LS-C749203 is an unconjugated rabbit polyclonal antibody to RANTES (CCL5) from human. It is reactive with human, mouse and rat. Validated for WB.
- Application
- WB
- Reactivity
- Hu, Ms, Rt
- Intended Use
- Research Use Only
- Guarantees
- This antibody carries the LSBio 100% Guarantee. ✓
- Category
- Antibodies > Primary Antibodies > Polyclonal Antibodies
- Alternative Names
- Chemokine (C-C motif) ligand 5 | CCL5 | D17S136E | EoCP | T-cell specific protein p288 | SCYA5 | SISd | T cell-specific protein P228 | Beta-chemokine RANTES | C-C motif chemokine 5 | RANTES | SIS-delta | Small-inducible cytokine A5 | T-cell-specific protein RANTES | TCP228
- UniProt Number
- P13501
- NCBI GenBank
- NM_002985 | NP_002976.2
- SwissProt
- P13501
Recommended Dilution
| Application | Dilution |
|---|---|
| WB | 1:500 - 1:2000 |
Target
- Target
- Human CCL5 / RANTES
- Antigen Species
- Human
- Gene Name
- CCL5
Antibody
- Host Species
- Rabbit
- Clonality
- Polyclonal
- Isotype
- IgG
- Origin Species
- Human
Immunogen
- Immunogen
- Recombinant fusion protein containing a sequence corresponding to amino acids 24-91 of human CCL5 (NP_002976.2). SPYSSDTTPCCFAYIARPLPRAHIKEYFYTSGKCSNPAVVFVTRKNRQVCANPEKKWVREYINSLEMS
- Immunogen Type
- Fusion Protein (e.g., GST, MBP tag)
Format
- Conjugate/Label
- Unconjugated
- Format
- Liquid
- Formulation
- PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
- Volume
- 20 Microliter
- Preservative
- Yes
- Purification Method
- Affinity Purified
Storage & Handling
- Storage Conditions
- Store at -20°C. Avoid freeze-thaw cycles.
- Recommended Storage Buffer
- PBS
