Polyclonal Rabbit anti-Human SLC5A11 / SMIT2 Antibody (WB)
Catalog Number: LS-C748223
2 sizes / from $281.00
Antibody: Rabbit Polyclonal
Applications: Immunohistochemistry (general), Western Blot
Reactivity: Human, Mouse, Rat
Format: Liquid
BMP4 antibody Western blot. All lanes: Anti BMP4 at 0.5 ug/ml. Lane 1: Mouse Lung Tissue Lysate at 50 ug. Lane 2: Mouse Liver Tissue Lysate at 50 ug. Lane 3: HEPA Whole Cell Lysate at 40 ug. Lane 4: HEPG2 Whole Cell Lysate at 40 ug. Lane 5: HELA Whole Cell Lysate at 40 ug. Predicted band size: 46 kD. Observed band size: 46 kD.
Polyclonal Rabbit anti-Human BMP4 Antibody (aa293-324, WB)
Primary AntibodyLSBio Guarantee
| Antibody: | Rabbit Polyclonal |
| Applications: | Enzyme-Linked Immunosorbent Assay, Western Blot |
| Reactivity: | Human, Mouse |
| Format: | Lyophilized |
$480.00each
Catalog Number: LS-C407900-100
Catalog Number: LS-C407900
For bulk orders or custom formulations:
Request a QuoteOverview
- Description
- BMP4 antibody LS-C407900 is an unconjugated rabbit polyclonal antibody to BMP4 (aa293-324) from human. It is reactive with human and mouse. Validated for ELISA and WB.
- Application
- ELISA, WB
- Reactivity
- Hu, Ms
- Intended Use
- RUO
- Guarantees
- This antibody carries the LSBio 100% Guarantee. ✓
- Category
- Antibodies > Primary Antibodies > Polyclonal Antibodies
- Alternative Names
- BMP-2B | BMP-4 | BMP2B | BMP2B1 | Bone morphogenetic protein 2B | Bone morphogenetic protein 4 | DVR4 | MCOPS6 | OFC11 | Zyme | BMP4
- Recommended Dilution: ELISA
- 0.1 - 0.5 ug/ml
- UniProt Number
- P12644
- NCBI GenBank
- NM_001202, NP_001193.2
- SwissProt
- P12644
Target
- Target
- Human BMP4
- Antigen Species
- Hu
- Epitope
- Expressed in the lung and lower levels seen in the kidney. Present also in normal and neoplastic prostate tissues, and prostate cancer cell lines.
- Gene Name
- BMP4
Antibody
- Host Species
- Rb
- Clonality
- Polyclonal
Immunogen
- Immunogen
- A synthetic peptide corresponding to a sequence at the C-Terminus of human BMP-4 (293-324 aa SPKHHSQRARKKNKNCRRHSLYVDFSDVGWND), different from the related mouse and rat sequences by two amino acids.
- Immunogen Type
- SP-Lin
Format
- Conjugate/Label
- Unconj
- Format
- Lyophilized
- Formulation
- Lyophilized from 0.2mg Na2HPO4, 5mg BSA, 0.9mg NaCl, 0.05mg sodium azide.
- Preservative
- Yes
- Purification Method
- AP
Storage & Handling
- Storage Conditions
- At -20°C for 1 year. After reconstitution, at 4°C for 1 month. It can also be aliquotted and stored frozen at -20°C for a longer time. Avoid freeze-thaw cycles.
- Recommended Storage Buffer
- NaCl
