LMNB2 / Lamin B2 Antibody
Catalog Number: LS-C659166-100
100 µL / $399.00
Antibody: Mouse Monoclonal
Applications: Immunoprecipitation, Western Blot
Reactivity: Human, Mouse
Format: Liquid
Western blot testing of human 1) HeLa, 2) HepG2, 3) MCF7, and 4) A549 lysate with BDKRB2 antibody at 0.5ug/ml. Predicted molecular weight ~44 kDa.
BDKRB2/Bradykinin B2 Receptor Antibody
Primary AntibodyLSBio Guarantee
| Antibody: | Rabbit Polyclonal |
| Applications: | Western Blot |
| Reactivity: | Human |
| Format: | Lyophilized |
$587.00each
Catalog Number: LS-C781847-100
Catalog Number: LS-C781847
For bulk orders or custom formulations:
Request a QuoteOverview
- Description
- Bradykinin B2 Receptor antibody LS-C781847 is an unconjugated rabbit polyclonal antibody to human Bradykinin B2 Receptor (BDKRB2). Validated for WB.
- Application
- WB
- Reactivity
- Hu
- Intended Use
- RUO
- Guarantees
- This antibody carries the LSBio 100% Guarantee. ✓
- Category
- Antibodies > Primary Antibodies > Polyclonal Antibodies
- Alternative Names
- BK-2 receptor | Bradykinin type-2 receptor | B2R | Bradykinin B2 receptor | BRB2 | BDKRB2 | BK-2R | BK-2Rs | BK2 | B2 bradykinin receptor | B2bkr | BK-2 | BKR2 | Bradykinin receptor B2
- Recommended Dilution: WB
- 0.5 - 1 µg/ml
- UniProt Number
- P30411
- NCBI GenBank
- NM_000623, NP_000614.1
- SwissProt
- P30411
Target
- Target
- Human BDKRB2/Bradykinin B2 Receptor
- Antigen Species
- Hu
- Gene Name
- BDKRB2
Antibody
- Host Species
- Rb
- Clonality
- Polyclonal
- Isotype
- IgG
- Origin Species
- Hu
Immunogen
- Immunogen
- Amino acids 357-391 (RSEPIQMENSMGTLRTSISVERQIHKLQDWAGSRQ) from the human protein were used as the immunogen for the BDKRB2 antibody.
Format
- Conjugate/Label
- Unconj
- Format
- Lyophilized
- Formulation
- Lyophilized from PBS, 2.5% BSA, 0.025% sodium azide.
- Preservative
- Yes
- Purification Method
- AP
Storage & Handling
- Storage Conditions
- After reconstitution, store at 4°C for up to 1 month. Long-term: aliquot and store at -20°C. Avoid freeze-thaws cycles.
- Recommended Storage Buffer
- PBS
