LMNB2 / Lamin B2 Antibody
Catalog Number: LS-C659166-100
100 µL / $399.00
Antibody: Mouse Monoclonal
Applications: Immunoprecipitation, Western Blot
Reactivity: Human, Mouse
Format: Liquid
Western blot - Anti-BDKRB2 Picoband Antibody
BDKRB2/Bradykinin B2 Receptor Antibody
Primary AntibodyLSBio Guarantee
| Antibody: | Rabbit Polyclonal |
| Applications: | Western Blot |
| Reactivity: | Human |
| Format: | Lyophilized |
$480.00each
Catalog Number: LS-C662333-100
Catalog Number: LS-C662333
For bulk orders or custom formulations:
Request a QuoteOverview
- Description
- Bradykinin B2 Receptor antibody LS-C662333 is an unconjugated rabbit polyclonal antibody to human Bradykinin B2 Receptor (BDKRB2). Validated for WB.
- Application
- WB
- Reactivity
- Hu
- Intended Use
- RUO
- Guarantees
- This antibody carries the LSBio 100% Guarantee. ✓
- Category
- Antibodies > Primary Antibodies > Polyclonal Antibodies
- Alternative Names
- BK-2 receptor | Bradykinin type-2 receptor | B2R | Bradykinin B2 receptor | BRB2 | BDKRB2 | BK-2R | BK-2Rs | BK2 | B2 bradykinin receptor | B2bkr | BK-2 | BKR2 | Bradykinin receptor B2
- UniProt Number
- P30411
- NCBI GenBank
- NM_000623, NP_000614.1
- SwissProt
- P30411
Target
- Target
- Human BDKRB2/Bradykinin B2 Receptor
- Antigen Species
- Hu
- Epitope
- Ubiquitous. Widespread in normal smooth muscle tissue and neurons. .
- Gene Name
- BDKRB2
Antibody
- Host Species
- Rb
- Clonality
- Polyclonal
Immunogen
- Immunogen
- A synthetic peptide corresponding to a sequence at the C-Terminus of human BDKRB2 (357-391 aa RSEPIQMENSMGTLRTSISVERQIHKLQDWAGSRQ), different from the related mouse sequence by five amino acids, and from the related rat sequence by seven amino acids.
- Immunogen Type
- SP-Lin
Format
- Conjugate/Label
- Unconj
- Format
- Lyophilized
- Formulation
- Lyophilized from 0.2mg Na2HPO4, 5mg BSA, 0.9mg NaCl, 0.05mg sodium azide.
- Preservative
- Yes
- Purification Method
- AP
Storage & Handling
- Storage Conditions
- At -20°C for 1 year. After reconstitution, at 4°C for 1 month. It can also be aliquotted and stored frozen at -20°C for a longer time. Avoid freeze-thaw cycles.
- Recommended Storage Buffer
- NaCl
