Polyclonal Rabbit anti-Human SLC5A11 / SMIT2 Antibody (WB)
Catalog Number: LS-C748223
2 sizes / from $281.00
Antibody: Rabbit Polyclonal
Applications: Immunohistochemistry (general), Western Blot
Reactivity: Human, Mouse, Rat
Format: Liquid
IHC analysis of Aquaporin 5 using anti-Aquaporin 5 antibody. Aquaporin 5 was detected in paraffin-embedded section of mouse lung tissue. Heat mediated antigen retrieval was performed in citrate buffer (pH6, epitope retrieval solution) for 20 mins. The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 2µg/ml rabbit anti-Aquaporin 5 Antibody overnight at 4°C. Biotinylated goat anti-rabbit IgG was used as secondary antibody and incubated for 30 minutes at 37°C. The tissue section was developed using Strepavidin-Biotin-Complex (SABC) with DAB as the chromogen.
Polyclonal Rabbit anti-Human AQP5 / Aquaporin 5 Antibody (IHC, WB)
Primary AntibodyLSBio Guarantee
| Antibody: | Rabbit Polyclonal |
| Applications: | Immunohistochemistry, Paraffin, Western Blot |
| Reactivity: | Human, Mouse, Rat |
| Format: | Lyophilized |
$480.00each
Catalog Number: LS-C756566-100
Catalog Number: LS-C756566
For bulk orders or custom formulations:
Request a QuoteOverview
- Description
- Aquaporin 5 antibody LS-C756566 is an unconjugated rabbit polyclonal antibody to Aquaporin 5 (AQP5) from human. It is reactive with human, mouse and rat. Validated for IHC and WB. Cited in 1 publication.
- Application
- IHC-P, WB
- Reactivity
- Hu, Ms, Rt
- Intended Use
- Research Use Only
- Guarantees
- This antibody carries the LSBio 100% Guarantee. ✓
- Category
- Antibodies > Primary Antibodies > Polyclonal Antibodies
- Alternative Names
- AQP5 | Aquaporin-5 | AQP-5 | Aquaporin 5
- Recommended Dilution: IHC-P
- 0.5 - 1 µg/ml
- Recommended Dilution: WB
- 0.1 - 0.5 µg/ml
- UniProt Number
- P55064
- NCBI GenBank
- NM_001651 | NP_001642.1
- SwissProt
- P55064
Target
- Target
- Human AQP5 / Aquaporin 5
- Antigen Species
- Human
- Epitope
- No cross reactivity with other proteins.
- Gene Name
- AQP5
Antibody
- Host Species
- Rabbit
- Clonality
- Polyclonal
- Isotype
- IgG
- Origin Species
- Human
Immunogen
- Immunogen
- A synthetic peptide corresponding to a sequence of human Aquaporin 5 (NSLSLSERVAIIKGTYEPDEDWEEQREERKKTMELTTR).
- Immunogen Type
- Synthetic Peptide (Linear)
Format
- Conjugate/Label
- Unconjugated
- Format
- Lyophilized
- Formulation
- Lyophilized from 0.2mg Na2HPO4, 0.9mg NaCl, 0.05mg sodium azide, 4mg Trehalose
- Preservative
- Yes
- Purification Method
- Affinity Purified
Storage & Handling
- Storage Conditions
- After reconstitution, may be stored at 4°C for 1 month. For long-term storage and to avoid freeze-thaw cycles, aliquot and store at -20°C.
- Recommended Storage Buffer
- NaCl
AQP5 enriches for stem cells and cancer origins in the distal stomach. Si Hui Tan , Yada Swathi , Shawna Tan, Jasmine Goh, Ryo Seishima, Kazuhiro Murakami, Masanobu Oshima, Toshikatsu Tsuji, Phyllis Phuah, Liang Thing Tan, Esther Wong, Aliya Fatehullah, Taotao Sheng, Shamaine Wei Ting Ho, Heike I Grabsch, Supriya Srivastava, Ming Teh, Simon L I J Denil, Seri Mustafah, Patrick Tan, Asim Shabbir, Jimmy So, Khay Guan Yeoh, Nick Barker. Nature. 2020 February;578:437-443. PubMed: 32025032
