Polyclonal Rabbit anti-Human SLC5A11 / SMIT2 Antibody (WB)
Catalog Number: LS-C748223
2 sizes / from $281.00
Antibody: Rabbit Polyclonal
Applications: Immunohistochemistry (general), Western Blot
Reactivity: Human, Mouse, Rat
Format: Liquid
Aquaporin 1 antibody Western blot. All lanes: Anti Aquaporin 1 at 0.5 ug/ml. Lane 1: Rat Kidney Tissue Lysate at 50 ug. Lane 2: Rat Lung Tissue Lysate at 50 ug. Lane 3: Rat Cardiac Muscle Tissue Lysate at 50 ug. Lane 4: PC-12 Whole Cell Lysate at 40 ug. Lane 5: HEPA Whole Cell Lysate at 40 ug. Predicted band size: 29 kD. Observed band size: 29 kD.
Polyclonal Rabbit anti-Human AQP1 / Aquaporin 1 Antibody (aa240-269, IHC, WB)
Primary AntibodyLSBio Guarantee
| Antibody: | Rabbit Polyclonal |
| Applications: | Immunohistochemistry (general), Immunohistochemistry, Paraffin, Western Blot |
| Reactivity: | Bovine, Human, Mouse, Rat, Sheep |
| Format: | Lyophilized |
$480.00each
Catalog Number: LS-C407687-100
Catalog Number: LS-C407687
For bulk orders or custom formulations:
Request a QuoteOverview
- Description
- Aquaporin 1 antibody LS-C407687 is an unconjugated rabbit polyclonal antibody to Aquaporin 1 (AQP1) (aa240-269) from human. It is reactive with human, mouse, rat and other species. Validated for IHC and WB.
- Application
- IHC, IHC-P, WB
- Reactivity
- Bov, Hu, Ms, Rt, Sh
- Intended Use
- Research Use Only
- Guarantees
- This antibody carries the LSBio 100% Guarantee. ✓
- Category
- Antibodies > Primary Antibodies > Polyclonal Antibodies
- Alternative Names
- AQP1 | Aquaporin-1 | AQP-1 | AQP-CHIP | Aquaporin 1 | Aquaporin-CHIP | CHIP28 | Colton blood group | Urine water channel | CO
- UniProt Number
- P29972
- NCBI GenBank
- NM_198098 | NP_932766.1
- SwissProt
- P29972
Target
- Target
- Human AQP1 / Aquaporin 1
- Antigen Species
- Human
- Epitope
- Detected in erythrocytes (at protein level). Expressed in a number of tissues including erythrocytes, renal tubules, retinal pigment epithelium, heart, lung, skeletal muscle, kidney and pancreas. Weakly expressed in brain, placenta and liver. .
- Gene Name
- AQP1
Antibody
- Host Species
- Rabbit
- Clonality
- Polyclonal
Immunogen
- Immunogen
- A synthetic peptide corresponding to a sequence at the C-Terminus of human Aquaporin 1 (240-269 aa DRVKVWTSGQVEEYDLDADDINSRVEMKPK), different from the related mouse and rat sequences by one amino acid.
- Immunogen Type
- Synthetic Peptide (Linear)
Format
- Conjugate/Label
- Unconjugated
- Format
- Lyophilized
- Formulation
- Lyophilized from 0.2mg Na2HPO4, 5mg BSA, 0.9mg NaCl, 0.05mg sodium azide.
- Preservative
- Yes
- Purification Method
- Affinity Purified
Storage & Handling
- Storage Conditions
- At -20°C for 1 year. After reconstitution, at 4°C for 1 month. It can also be aliquotted and stored frozen at -20°C for a longer time. Avoid freeze-thaw cycles.
- Recommended Storage Buffer
- NaCl
