
AHSG / Fetuin A Antibody
Primary AntibodyLSBio Guarantee
| Antibody: | Rabbit Polyclonal |
| Applications: | Enzyme-Linked Immunosorbent Assay, Immunohistochemistry (general), Immunohistochemistry, Paraffin, Western Blot |
| Reactivity: | Human, Rat |
| Format: | Lyophilized |
$587.00each
Catalog Number: LS-C490242-100
Catalog Number: LS-C490242
For bulk orders or custom formulations:
Request a QuoteOverview
- Description
- Fetuin A antibody LS-C490242 is an unconjugated rabbit polyclonal antibody to Fetuin A (AHSG) from human. It is reactive with human and rat. Validated for ELISA, IHC and WB.
- Application
- ELISA, IHC, IHC-P, WB
- Reactivity
- Hu, Rt
- Intended Use
- Research Use Only
- Guarantees
- This antibody carries the LSBio 100% Guarantee. ✓
- Category
- Antibodies > Primary Antibodies > Polyclonal Antibodies
- Alternative Names
- A2HS | Alpha-2-Z-globulin | Fetuin | Fetuin-A | AHS | AHSG | Alpha-2-HS-glycoprotein | Ba-alpha-2-glycoprotein | FETUA | HSGA
- UniProt Number
- P02765
- NCBI GenBank
- NM_001622 | NP_001613.2
- SwissProt
- P02765
Recommended Dilution
| Application | Dilution |
|---|---|
| IHC-P | 0.5 - 1 µg/ml |
| WB | 0.1 - 0.5 µg/ml |
Target
- Target
- Human AHSG / Fetuin A
- Antigen Species
- Human
- Gene Name
- AHSG
Antibody
- Host Species
- Rabbit
- Clonality
- Polyclonal
- Isotype
- IgG
Immunogen
- Immunogen
- Amino acids DDPETEEAALVAIDYINQNLPWGYKHTLNQIDE of human AHSG were used as the immunogen for the AHSG antibody.
- Immunogen Type
- Peptide
Format
- Conjugate/Label
- Unconjugated
- Format
- Lyophilized
- Formulation
- Lyophilized from PBS, 2.5% BSA, 0.025% sodium azide.
- Preservative
- Yes
- Purification Method
- Affinity Purified
Storage & Handling
- Storage Conditions
- Store at -20°C. Avoid freeze-thaw cycles.
- Recommended Storage Buffer
- PBS
