Overview

Description:

SNCA / Alpha-Synuclein Protein LS-G141283 is a Recombinant Human SNCA / Alpha-Synuclein produced in E. coli. For Research Use Only

Specifications

Type

Recombinant Protein

Target

SNCA / Alpha-Synuclein

Synonyms

Species

Human

Modifications

Unmodified

Conjugations

Unconjugated

AA Sequence

MDVFMKGLSKAKEGVVAAAEKTKQGVAEAAGKTKEGVLYVGSKTKEGVVHGVATVAEKTKEQVTNVGGAVVTGVTAVAQKTVEGAGSIAAATGFVKKDQLGKNEEGAPQEGILEDMPVDPDNEAYEMPSEEGYQDYEPEA

Expression System

E. coli

Source Species

E. coli

Purification

Greater than 92% by SDS-PAGE

Bio-Activity

Does not induce Lewy body inclusion formation in Sprague-Dawley rat primary hippocampal neurons. Thioflavin T emission curve shows only a small increase in fluorescence (indicative of alpha synuclein aggregation) when Type 2 alpha synuclein PFFs are combined with alpha synuclein monomers. Certain biological activities in other neuronal cells cannot be ruled out. Researchers should test compatibility prior to use.

Endotoxin

Not Tested

Presentation

PBS, pH 7.4

Storage

Store at -80°C.

Restrictions

For research use only. Intended for use by laboratory professionals. Available for shipment within the USA only

Guarantee

This protein carries the LSBio 100% Guarantee.

LSBio Guarantee

About SNCA / Alpha-Synuclein

Uniprot: P37840 NCBI: NM_000345 NP_000336.1

Publications (0)

Submit a Publication for LS-G141283

Customer Reviews (0)

Submit a review for LS-G141283

Images

Immunofluorescence

SNCA / Alpha-Synuclein Protein - Primary rat hippocampal neurons show lewy body inclusion formation when treated with Type 1 Alpha Synuclein Preformed Fibrils at 4 µg/ml (D-F), but not when treated with Type 2 Alpha Synuclein Preformed Fibrils at 4 µg/ml (A-C). Tissue: Primary hippocampal neurons. Species: Sprague-Dawley rat. Fixation: 4% formaldehyde made from PFA. Primary Antibody: Mouse anti-pSer129 Antibody at 1:1000 24 hours at 4°C. Secondary Antibody: FITC Goat Anti-Mouse (green) at 1:700 for 1 hours at RT. Counterstain: Hoechst (blue) nuclear stain at 1:4000 for 1 hour at RT. Localization: Lewy body inclusions. Magnification: 20x.

Primary rat hippocampal neurons show lewy body inclusion formation when treated with Type 1 Alpha Synuclein Preformed Fibrils at 4 µg/ml (D-F), but not when treated with Type 2 Alpha Synuclein Preformed Fibrils at 4 µg/ml (A-C). Tissue: Primary hippocampal neurons. Species: Sprague-Dawley rat. Fixation: 4% formaldehyde made from PFA. Primary Antibody: Mouse anti-pSer129 Antibody at 1:1000 24 hours at 4°C. Secondary Antibody: FITC Goat Anti-Mouse (green) at 1:700 for 1 hours at RT. Counterstain: Hoechst (blue) nuclear stain at 1:4000 for 1 hour at RT. Localization: Lewy body inclusions. Magnification: 20x.

Electron Microscopy

TEM of Type 2 Alpha Synuclein Preformed Fibrils (PFFs)

Functional Assay

SNCA / Alpha-Synuclein Protein - Toxicity results comparing Active Human Recombinant Alpha Synuclein Preformed Fibrils (Type 2) (Catalog No. SPR-317) and Active Human Recombinant Alpha Synuclein Preformed Fibrils (Type 1) (Catalog No. SPR-322). Data was graphed after live cell imaging results were obtained using the following procedure: After 8 days in vitro, primary rat mixed cortical neuron cells were washed with 1X PBS and treated with 500 µg/ml of Type 1 and Type 2 Alpha Synuclein Proteins for 20 hours at 37?C. Following treatements, cells were washed with 2X PBS and incubated with a staining solution (2.0 µM Cell Event + 2.5 µM Ethidium homodimer + 2.5 µg/ml Hoechst 33342 in sterile HBSS) for 30 minutes at 37?C. The addition of the Type 2 Alpha Synuclein Proteins resulted in a significant increase in cell death.

Toxicity results comparing Active Human Recombinant Alpha Synuclein Preformed Fibrils (Type 2) (Catalog No. SPR-317) and Active Human Recombinant Alpha Synuclein Preformed Fibrils (Type 1) (Catalog No. SPR-322). Data was graphed after live cell imaging results were obtained using the following procedure: After 8 days in vitro, primary rat mixed cortical neuron cells were washed with 1X PBS and treated with 500 µg/ml of Type 1 and Type 2 Alpha Synuclein Proteins for 20 hours at 37?C. Following treatements, cells were washed with 2X PBS and incubated with a staining solution (2.0 µM Cell Event + 2.5 µM Ethidium homodimer + 2.5 µg/ml Hoechst 33342 in sterile HBSS) for 30 minutes at 37?C. The addition of the Type 2 Alpha Synuclein Proteins resulted in a significant increase in cell death.

Sodium Dodecyl Sulfate - Polyacrylamide Gel Electrophoresis

SNCA / Alpha-Synuclein Protein - SDS-PAGE of ~14 kDa Human Recombinant Alpha Synuclein Protein Preformed Fibrils (Type 2). Lane 1: Molecular Weight Ladder (MW). Lane 2: Alpha Synuclein Protein Preformed Fibrils.

SDS-PAGE of ~14 kDa Human Recombinant Alpha Synuclein Protein Preformed Fibrils (Type 2). Lane 1: Molecular Weight Ladder (MW). Lane 2: Alpha Synuclein Protein Preformed Fibrils.

Immunofluorescence

Primary rat hippocampal neurons show lewy body inclusion formation when treated with Type 1 Alpha Synuclein Preformed Fibrils at 4 µg/ml (D-F), but not when treated with Type 2 Alpha Synuclein Preformed Fibrils at 4 µg/ml (A-C). Tissue: Primary hippocampal neurons. Species: Sprague-Dawley rat. Fixation: 4% formaldehyde made from PFA. Primary Antibody: Mouse anti-pSer129 Antibody at 1:1000 24 hours at 4°C. Secondary Antibody: FITC Goat Anti-Mouse (green) at 1:700 for 1 hours at RT. Counterstain: Hoechst (blue) nuclear stain at 1:4000 for 1 hour at RT. Localization: Lewy body inclusions. Magnification: 20x.

Electron Microscopy

TEM of Type 2 Alpha Synuclein Preformed Fibrils (PFFs)

Functional Assay

Toxicity results comparing Active Human Recombinant Alpha Synuclein Preformed Fibrils (Type 2) (Catalog No. SPR-317) and Active Human Recombinant Alpha Synuclein Preformed Fibrils (Type 1) (Catalog No. SPR-322). Data was graphed after live cell imaging results were obtained using the following procedure: After 8 days in vitro, primary rat mixed cortical neuron cells were washed with 1X PBS and treated with 500 µg/ml of Type 1 and Type 2 Alpha Synuclein Proteins for 20 hours at 37?C. Following treatements, cells were washed with 2X PBS and incubated with a staining solution (2.0 µM Cell Event + 2.5 µM Ethidium homodimer + 2.5 µg/ml Hoechst 33342 in sterile HBSS) for 30 minutes at 37?C. The addition of the Type 2 Alpha Synuclein Proteins resulted in a significant increase in cell death.

Sodium Dodecyl Sulfate - Polyacrylamide Gel Electrophoresis

SDS-PAGE of ~14 kDa Human Recombinant Alpha Synuclein Protein Preformed Fibrils (Type 2). Lane 1: Molecular Weight Ladder (MW). Lane 2: Alpha Synuclein Protein Preformed Fibrils.

Immunofluorescence

Primary rat hippocampal neurons show lewy body inclusion formation when treated with Type 1 Alpha Synuclein Preformed Fibrils at 4 µg/ml (D-F), but not when treated with Type 2 Alpha Synuclein Preformed Fibrils at 4 µg/ml (A-C). Tissue: Primary hippocampal neurons. Species: Sprague-Dawley rat. Fixation: 4% formaldehyde made from PFA. Primary Antibody: Mouse anti-pSer129 Antibody at 1:1000 24 hours at 4°C. Secondary Antibody: FITC Goat Anti-Mouse (green) at 1:700 for 1 hours at RT. Counterstain: Hoechst (blue) nuclear stain at 1:4000 for 1 hour at RT. Localization: Lewy body inclusions. Magnification: 20x.

Electron Microscopy

TEM of Type 2 Alpha Synuclein Preformed Fibrils (PFFs)

Functional Assay

Toxicity results comparing Active Human Recombinant Alpha Synuclein Preformed Fibrils (Type 2) (Catalog No. SPR-317) and Active Human Recombinant Alpha Synuclein Preformed Fibrils (Type 1) (Catalog No. SPR-322). Data was graphed after live cell imaging results were obtained using the following procedure: After 8 days in vitro, primary rat mixed cortical neuron cells were washed with 1X PBS and treated with 500 µg/ml of Type 1 and Type 2 Alpha Synuclein Proteins for 20 hours at 37?C. Following treatements, cells were washed with 2X PBS and incubated with a staining solution (2.0 µM Cell Event + 2.5 µM Ethidium homodimer + 2.5 µg/ml Hoechst 33342 in sterile HBSS) for 30 minutes at 37?C. The addition of the Type 2 Alpha Synuclein Proteins resulted in a significant increase in cell death.

Sodium Dodecyl Sulfate - Polyacrylamide Gel Electrophoresis

SDS-PAGE of ~14 kDa Human Recombinant Alpha Synuclein Protein Preformed Fibrils (Type 2). Lane 1: Molecular Weight Ladder (MW). Lane 2: Alpha Synuclein Protein Preformed Fibrils.

Immunofluorescence

Primary rat hippocampal neurons show lewy body inclusion formation when treated with Type 1 Alpha Synuclein Preformed Fibrils at 4 µg/ml (D-F), but not when treated with Type 2 Alpha Synuclein Preformed Fibrils at 4 µg/ml (A-C). Tissue: Primary hippocampal neurons. Species: Sprague-Dawley rat. Fixation: 4% formaldehyde made from PFA. Primary Antibody: Mouse anti-pSer129 Antibody at 1:1000 24 hours at 4°C. Secondary Antibody: FITC Goat Anti-Mouse (green) at 1:700 for 1 hours at RT. Counterstain: Hoechst (blue) nuclear stain at 1:4000 for 1 hour at RT. Localization: Lewy body inclusions. Magnification: 20x.

Electron Microscopy

TEM of Type 2 Alpha Synuclein Preformed Fibrils (PFFs)

Functional Assay

Toxicity results comparing Active Human Recombinant Alpha Synuclein Preformed Fibrils (Type 2) (Catalog No. SPR-317) and Active Human Recombinant Alpha Synuclein Preformed Fibrils (Type 1) (Catalog No. SPR-322). Data was graphed after live cell imaging results were obtained using the following procedure: After 8 days in vitro, primary rat mixed cortical neuron cells were washed with 1X PBS and treated with 500 µg/ml of Type 1 and Type 2 Alpha Synuclein Proteins for 20 hours at 37?C. Following treatements, cells were washed with 2X PBS and incubated with a staining solution (2.0 µM Cell Event + 2.5 µM Ethidium homodimer + 2.5 µg/ml Hoechst 33342 in sterile HBSS) for 30 minutes at 37?C. The addition of the Type 2 Alpha Synuclein Proteins resulted in a significant increase in cell death.

Sodium Dodecyl Sulfate - Polyacrylamide Gel Electrophoresis

SDS-PAGE of ~14 kDa Human Recombinant Alpha Synuclein Protein Preformed Fibrils (Type 2). Lane 1: Molecular Weight Ladder (MW). Lane 2: Alpha Synuclein Protein Preformed Fibrils.