LSBio The Immunohistochemistry Antibody Company
  • Antibodies
  • All Antibodies
  • Primary Antibodies
  • Secondary Antibodies
  • IHC-plus Antibodies
  • Isotype Control Antibodies
  • ELISA Kits
  • All Kits
  • Sandwich ELISA Kits
  • Competitive EIA Kits
  • Cell-Based ELISA Kits
  • DNA-Binding ELISA Kits
  • Direct ELISA Kits
  • Functional ELISA Kits
  • Phospho-Specific ELISA Kits
  • Custom ELISA Kits
  • Proteins
  • All Proteins
  • Recombinant Proteins
  • Native Proteins
  • Over-expression Lysates
  • Cell and Tissue Lysates
  • Bio-active Proteins
  • Animal-free Proteins
  • Immunohistochemistry
  • Comprehensive IHC Reports
  • Custom IHC Services
  • TCR Screening Services
  • IHC-plus Antibodies
  • Other
  • Blocking Peptides
  • Immunohistochemistry Services

  • Work with LifeSpan to design a custom immunohistochemistry to address your specific biological question. Outsource the entire localization process without having to worry about finding and characterizing target specific antibodies, sourcing and validating difficult-to-find tissues, and having the ability to interpret the resulting immunostaining in relation to complex human pathologies.

  • TCR Screening Services

  • Test your therapeutic antibodies in immunohistochemistry against a broad panel of normal frozen human tissue types in order to determine potential unintended binding. Our non-GLP TCR services are designed on the FDA recommendation outlined in their "Points to Consider in the Manufacture and Testing of Monoclonal Antibody Products for Human Use".
Have a question?
  • Purchasing
  • Product Ordering Terms and Conditions
  • Holiday Schedule
  • About the LSBio Guarantee
  • About Our Rewards Program
  • Reference Material
  • About LSBio (LifeSpan BioSciences Inc.)
  • About Our 2-million Specimen Tissue Bank
  • About Our IHC Validation Process
  • About Our IHC-plus™ Protocol
  • Publications
  • Secure Logins
  • Login to Our Secure FTP Site
  • Login to Our IHC Database
Contact Us

2401 Fourth Avenue Suite 900
Seattle WA 98121

Phone: 866-819-4732 (Toll Free North America)
206-374-1102 (International)

Fax: 866-206-6909 (Toll Free North America)
206-577-4565 (International)
How to Buy - Details about how to buy our products. - To submit a new order. - To submit questions about existing orders, pricing, availability, bulk quotes, proforma invoice requests, or other billing issues. - To request technical information requests about an LSBio product or its application. - To request information about fee-for-service contract IHC studies, IHC reports, distribution agreements, or general business development.

Worldwide Distributors List - To find your local distributor if you're not within the United States.
Quick Order ▾
View Cart

We have a collection of 387,151 monoclonal and polyclonal antibodies to most target proteins. They cover all major research species, applications, and are available in multiple conjugated forms. Our IHC-plus™ antibodies are highly characterized for use in FFPE human tissue Immunohistochemistry.


ELISA Kits are a fast, cost effective way to measure the presence of specific protein or molecular analytes in a variety of sample types, such as urine, cell lysates, and in vitro. We offer multiple types of immunoassays, covering 1000's of analytes, in order to meet your specific needs.


Proteins can be used in a wide variety of applications, such as for the development of functional assays, small-molecule screening, receptor activation in-situ, or simply as controls for a Western Blot. We offer extracted native proteins and recombinant proteins in the form of cell lysates, or purified from bacterial or mammalian expression systems. Many proteins are bio-active and certified low-endotoxin.


Over the past 20 years we've conducted 1000's of custom IHC studies. Our staff of pathologists are experienced in designing effective IHC studies and interpreting the results in relation to normal and disease processes. These services are supported by our massive tissue bank that contains virtually every tissue type and disease.

Contact Us
Most Popular Antibodies
Anti-RGR Antibody (Extracellular Domain) IHC-plus™ LS-A1043

LS-A1043 is a rabbit anti-RGR polyclonal antibody approved for use in Immunohistochemistry - Paraffin.

About RGR: RGR is a putative retinal G-protein coupled receptor. The gene is a member of the opsin subfamily of the 7 transmembrane, G-protein coupled receptor 1 family. Like other opsins which bind retinaldehyde, it contains a conserved lysine residue in the seventh transmembrane domain. The protein acts as a photoisomerase to catalyze the conversion of all-trans-retinal to 11-cis-retinal. The reverse isomerization occurs with rhodopsin in retinal photoreceptor cells. The protein is exclusively expressed in tissue adjacent to retinal photoreceptor cells, the retinal pigment epithelium and Mueller cells. This gene may be associated with autosomal recessive and autosomal dominant retinitis pigmentosa (arRP and adRP, respectively). (more)

Immunohistochemistry Image
Anti-DRD2 / Dopamine Receptor D2 Antibody (Cytoplasmic Domain) IHC-plus™ LS-A1405

LS-A1405 is a rabbit anti-DRD2 / Dopamine Receptor D2 polyclonal antibody approved for use in Immunohistochemistry - Paraffin.

About DRD2 / Dopamine Receptor D2: DRD2 / Dopamine Receptor D2 is the D2 subtype of the dopamine receptor. This G-protein coupled receptor inhibits adenylyl cyclase activity. A missense mutation in this gene causes myoclonus dystonia; other mutations have been associated with schizophrenia. Alternative splicing of this gene results in two transcript variants encoding different isoforms. A third variant has been described, but it has not been determined whether this form is normal or due to aberrant splicing. (more)

Immunohistochemistry Image
Anti-EPHA4 / EPH Receptor A4 Antibody (Internal) IHC-plus™ LS-A2839

LS-A2839 is a rabbit anti-EPHA4 / EPH Receptor A4 polyclonal antibody approved for use in Immunohistochemistry - Paraffin.

About EPHA4 / EPH Receptor A4: Receptor tyrosine kinase which binds membrane-bound ephrin family ligands residing on adjacent cells, leading to contact-dependent bidirectional signaling into neighboring cells. The signaling pathway downstream of the receptor is referred to as forward signaling while the signaling pathway downstream of the ephrin ligand is referred to as reverse signaling. Highly promiscuous, it has the unique property among Eph receptors to bind and to be physiologically activated by both GPI-anchored ephrin-A and transmembrane ephrin-B ligands including EFNA1 and EFNB3. Upon activation by ephrin ligands, modulates cell morphology and integrin-dependent cell adhesion through regulation of the Rac, Rap and Rho GTPases activity. (more)

Immunohistochemistry Image
Anti-DKK1 Antibody (Cytoplasmic Domain) IHC-plus™ LS-A2867

LS-A2867 is a rabbit anti-DKK1 polyclonal antibody approved for use in Immunohistochemistry - Paraffin.

About DKK1: Antagonizes canonical Wnt signaling by inhibiting LRP5/6 interaction with Wnt and by forming a ternary complex with the transmembrane protein KREMEN that promotes internalization of LRP5/6. DKKs play an important role in vertebrate development, where they locally inhibit Wnt regulated processes such as antero-posterior axial patterning, limb development, somitogenesis and eye formation. In the adult, Dkks are implicated in bone formation and bone disease, cancer and Alzheimer disease. (more)

Immunohistochemistry Image
Anti-CDKN2A / p16INK4a Antibody (N-Terminus) IHC-plus™ LS-B1347

LS-B1347 is a rabbit anti-CDKN2A / p16INK4a polyclonal antibody approved for use in Immunohistochemistry - Paraffin and Western blot.

About CDKN2A / p16INK4a: Capable of inducing cell cycle arrest in G1 and G2 phases. Acts as a tumor suppressor. Binds to MDM2 and blocks its nucleocytoplasmic shuttling by sequestering it in the nucleolus. This inhibits the oncogenic action of MDM2 by blocking MDM2-induced degradation of p53 and enhancing p53-dependent transactivation and apoptosis. Also induces G2 arrest and apoptosis in a p53-independent manner by preventing the activation of cyclin B1/CDC2 complexes. Binds to BCL6 and down-regulates BCL6-induced transcriptional repression. Binds to E2F1 and MYC and blocks their transcriptional activator activity but has no effect on MYC transcriptional repression. Binds to TOP1/TOPOI and stimulates its activity. (more)

Immunohistochemistry Image
Anti-SP1 Antibody (Internal) IHC-plus™ LS-B1647

LS-B1647 is a rabbit anti-SP1 polyclonal antibody approved for use in Immunohistochemistry - Paraffin and Western blot.

About SP1: Transcription factor that can activate or repress transcription in response to physiological and pathological stimuli. Binds with high affinity to GC-rich motifs and regulates the expression of a large number of genes involved in a variety of processes such as cell growth, apoptosis, differentiation and immune responses. Highly regulated by post-translational modifications (phosphorylations, sumoylation, proteolytic cleavage, glycosylation and acetylation). Binds also the PDGFR-alpha G-box promoter. May have a role in modulating the cellular response to DNA damage. Implicated in chromatin remodeling. Plays a role in the recruitment of SMARCA4/BRG1 on the c-FOS promoter. Plays an essential role in the regulation of FE65 gene expression. (more)

Immunohistochemistry Image
Anti-MMP13 Antibody (Internal) IHC-plus™ LS-A1553

LS-A1553 is a rabbit anti-MMP13 polyclonal antibody approved for use in Immunohistochemistry - Paraffin.

About MMP13: Plays a role in the degradation of extracellular matrix proteins including fibrillar collagen, fibronectin, TNC and ACAN. Cleaves triple helical collagens, including type I, type II and type III collagen, but has the highest activity with soluble type II collagen. Can also degrade collagen type IV, type XIV and type X. May also function by activating or degrading key regulatory proteins, such as TGFB1 and CTGF. Plays a role in wound healing, tissue remodeling, cartilage degradation, bone development, bone mineralization and ossification. Required for normal embryonic bone development and ossification. Plays a role in the healing of bone fractures via endochondral ossification. (more)

Immunohistochemistry Image
Anti-MAP2 Antibody LS-C61805

LS-C61805 is a chicken anti-MAP2 polyclonal antibody approved for use in Immunofluorescence and Western blot.

About MAP2: MAP2 is a protein that belongs to the microtubule-associated protein family. The proteins of this family are thought to be involved in microtubule assembly, which is an essential step in neurogenesis. The products of similar genes in rat and mouse are neuron-specific cytoskeletal proteins that are enriched in dentrites, implicating a role in determining and stabilizing dentritic shape during neuron development. A number of alternatively spliced variants encoding distinct isoforms have been described. (more)

Immunofluorescence Image
Anti-LAG3 Antibody (aa70-99, clone 17B4, FITC) IHC-plus™ LS-B2237

LS-B2237 is a Fluorescein mouse anti-LAG3 monoclonal antibody approved for use in Flow Cytometry and Immunohistochemistry - Paraffin.

About LAG3: Lymphocyte-Activation Protein 3 (LAG3) belongs to Ig superfamily and contains 4 extracellular Ig-like domains. The LAG3 gene contains 8 exons. The sequence data, exon/intron organization, and chromosomal localization all indicate a close relationship of LAG3 to CD4. (more)

Immunohistochemistry Image
Anti-TSLP Antibody (Internal) IHC-plus™ LS-B3208

LS-B3208 is a rabbit anti-TSLP polyclonal antibody approved for use in Enzyme-Linked Immunosorbent Assay, Immunohistochemistry - Paraffin and Western blot.

About TSLP: TSLP is a hemopoietic cytokine proposed to signal through a heterodimeric receptor complex composed of the thymic stromal lymphopoietin receptor and the IL-7R alpha chain. It mainly impacts myeloid cells and induces the release of T cell-attracting chemokines from monocytes and enhances the maturation of CD11c(+) dendritic cells. The protein promotes T helper type 2 (TH2) cell responses that are associated with immunity in various inflammatory diseases, including asthma, allergic inflammation and chronic obstructive pulmonary disease. The protein is therefore considered a potential therapeutic target for the treatment of such diseases. Alternative splicing of this gene results in multiple transcript variants. (more)

Immunohistochemistry Image
Anti-IL12 Antibody (Biotin) LS-C104425

LS-C104425 is a Biotin goat anti-IL12 polyclonal antibody approved for use in Enzyme-Linked Immunosorbent Assay, Neutralization and Western blot. (more)

Western blot Image
Anti-MIF Antibody (clone 2A10-4D3) LS-C104992

LS-C104992 is a mouse anti-MIF monoclonal antibody approved for use in Enzyme-Linked Immunosorbent Assay, Immunohistochemistry - Paraffin and Western blot.

About MIF: Pro-inflammatory cytokine. Involved in the innate immune response to bacterial pathogens. The expression of MIF at sites of inflammation suggests a role as mediator in regulating the function of macrophages in host defense. Counteracts the anti-inflammatory activity of glucocorticoids. Has phenylpyruvate tautomerase and dopachrome tautomerase activity (in vitro), but the physiological substrate is not known. It is not clear whether the tautomerase activity has any physiological relevance, and whether it is important for cytokine activity. (more)

Immunohistochemistry Image
Anti-VTCN1 / B7-H4 Antibody (clone H74) IHC-plus™ LS-B4055

LS-B4055 is a mouse anti-VTCN1 / B7-H4 monoclonal antibody approved for use in Flow Cytometry and Immunohistochemistry - Paraffin.

About VTCN1 / B7-H4: Negatively regulates T-cell-mediated immune response by inhibiting T-cell activation, proliferation, cytokine production and development of cytotoxicity. When expressed on the cell surface of tumor macrophages, plays an important role, together with regulatory T-cells (Treg), in the suppression of tumor-associated antigen-specific T-cell immunity. Involved in promoting epithelial cell transformation. (more)

Immunohistochemistry Image
Anti-CD79A / CD79 Alpha Antibody (clone HM57) IHC-plus™ LS-B4504

LS-B4504 is a mouse anti-CD79A / CD79 Alpha monoclonal antibody approved for use in Flow Cytometry, Immunohistochemistry - Frozen and Immunohistochemistry - Paraffin.

About CD79A / CD79 Alpha: Required in cooperation with CD79B for initiation of the signal transduction cascade activated by binding of antigen to the B-cell antigen receptor complex (BCR) which leads to internalization of the complex, trafficking to late endosomes and antigen presentation. Also required for BCR surface expression and for efficient differentiation of pro- and pre-B-cells. Stimulates SYK autophosphorylation and activation. Binds to BLNK, bringing BLNK into proximity with SYK and allowing SYK to phosphorylate BLNK. Also interacts with and increases activity of some Src-family tyrosine kinases. Represses BCR signaling during development of immature B-cells. (more)

Immunohistochemistry Image
Anti-Sialylated Lewis a / CA 19-9 Antibody LS-C122776

LS-C122776 is a mouse anti-Sialylated Lewis a / CA 19-9 monoclonal antibody approved for use in Immunohistochemistry - Paraffin.

About Sialylated Lewis a / CA 19-9: Sialylated Lewis Antigen (CA19-9) (more)

Immunohistochemistry - Paraffin Image
Anti-FGF21 Antibody (clone 2F11) LS-C133715

LS-C133715 is a mouse anti-FGF21 monoclonal antibody approved for use in Enzyme-Linked Immunosorbent Assay, Immunohistochemistry - Paraffin and Western blot.

About FGF21: Stimulates glucose uptake in differentiated adipocytes via the induction of glucose transporter SLC2A1/GLUT1 expression (but not SLC2A4/GLUT4 expression). Activity requires the presence of KLB. (more)

Immunohistochemistry Image
Anti-CD27L / CD70 Antibody (clone BU69, RPE) LS-C134547

LS-C134547 is a R. Phycoerythrin mouse anti-CD27L / CD70 monoclonal antibody approved for use in Enzyme-Linked Immunosorbent Assay, Flow Cytometry, Functional Assay, Immunocytochemistry and Immunohistochemistry - Frozen.

About CD27L / CD70: CD27L / CD70 is a cytokine that belongs to the tumor necrosis factor (TNF) ligand family. This cytokine is a ligand for TNFRSF27/CD27. It is a surface antigen on activated, but not on resting, T and B lymphocytes. It induces proliferation of costimulated T cells, enhances the generation of cytolytic T cells, and contributes to T cell activation. This cytokine is also reported to play a role in regulating B-cell activation, cytotoxic function of natural killer cells, and immunoglobulin sythesis. (more)

Flow Cytometry Image
Anti-TNFSF4 / OX40L Antibody (clone ANC10G1, Biotin) LS-C134809

LS-C134809 is a Biotin mouse anti-TNFSF4 / OX40L monoclonal antibody approved for use in Enzyme-Linked Immunosorbent Assay, Flow Cytometry and Functional Assay.

About TNFSF4 / OX40L: TNFSF4 / OX40L is a cytokine of the tumor necrosis factor (TNF) ligand family. The encoded protein functions in T cell antigen-presenting cell (APC) interactions and mediates adhesion of activated T cells to endothelial cells. Polymorphisms in this gene have been associated with Sjogren's syndrome and systemic lupus erythematosus. Alternative splicing results in multiple transcript variants. (more)

Flow Cytometry Image
Anti-FABP7 / BLBP / MRG Antibody (aa1-132, clone AT1D1) IHC-plus™ LS-B6684

LS-B6684 is a mouse anti-FABP7 / BLBP / MRG monoclonal antibody approved for use in Enzyme-Linked Immunosorbent Assay, Immunohistochemistry - Paraffin and Western blot.

About FABP7 / BLBP / MRG: B-FABP could be involved in the transport of a so far unknown hydrophobic ligand with potential morphogenic activity during CNS development. It is required for the establishment of the radial glial fiber system in developing brain, a system that is necessary for the migration of immature neurons to establish cortical layers. (more)

Immunohistochemistry Image
Anti-PDCD1 / CD279 / PD-1 Antibody (clone J116) IHC-plus™ LS-B7883

LS-B7883 is a mouse anti-PDCD1 / CD279 / PD-1 monoclonal antibody approved for use in Flow Cytometry, Immunohistochemistry - Frozen, Immunohistochemistry - Paraffin, Immunoprecipitation and Western blot.

About PDCD1 / CD279 / PD-1: PDCD1 / CD279 / PD-1 is a cell surface membrane protein of the immunoglobulin superfamily. This protein is expressed in pro-B-cells and is thought to play a role in their differentiation. In mice, expression of this gene is induced in the thymus when anti-CD3 antibodies are injected and large numbers of thymocytes undergo apoptosis. Mice deficient for this gene bred on a BALB/c background developed dilated cardiomyopathy and died from congestive heart failure. These studies suggest that this gene product may also be important in T cell function and contribute to the prevention of autoimmune diseases. (more)

Immunohistochemistry Image
Anti-RPS6KA1 / RSK1 Antibody (phospho-Ser732) LS-C154250

LS-C154250 is a rabbit anti-RPS6KA1 / RSK1 polyclonal antibody approved for use in Enzyme-Linked Immunosorbent Assay and Western blot.

About RPS6KA1 / RSK1: Serine/threonine-protein kinase that acts downstream of ERK (MAPK1/ERK2 and MAPK3/ERK1) signaling and mediates mitogenic and stress-induced activation of the transcription factors CREB1, ETV1/ER81 and NR4A1/NUR77, regulates translation through RPS6 and EIF4B phosphorylation, and mediates cellular proliferation, survival, and differentiation by modulating mTOR signaling and repressing pro-apoptotic function of BAD and DAPK1. In fibroblast, is required for EGF-stimulated phosphorylation of CREB1, which results in the subsequent transcriptional activation of several immediate-early genes. In response to mitogenic stimulation (EGF and PMA), phosphorylates and activates NR4A1/NUR77 and ETV1/ER81 transcription factors and the cofactor CREBBP. (more)

Western blot Image
Anti-IL17A Antibody (aa1-75, clone 4K5F6) IHC-plus™ LS-B8323

LS-B8323 is a mouse anti-IL17A monoclonal antibody approved for use in Flow Cytometry, Immunohistochemistry - Paraffin and Western blot.

About IL17A: IL17A is a proinflammatory cytokine produced by activated T cells. This cytokine regulates the activities of NF-kappaB and mitogen-activated protein kinases. This cytokine can stimulate the expression of IL6 and cyclooxygenase-2 (PTGS2/COX-2), as well as enhance the production of nitric oxide (NO). High levels of this cytokine are associated with several chronic inflammatory diseases including rheumatoid arthritis, psoriasis and multiple sclerosis. (more)

Immunohistochemistry Image
Anti-KRAS Antibody (clone 2C1) LS-C175665

LS-C175665 is a mouse anti-KRAS monoclonal antibody approved for use in Western blot.

About KRAS: This gene, a Kirsten ras oncogene homolog from the mammalian ras gene family, encodes a protein that is a member of the small GTPase superfamily. A single amino acid substitution is responsible for an activating mutation. The transforming protein that results is implicated in various malignancies, including lung adenocarcinoma, mucinous adenoma, ductal carcinoma of the pancreas and colorectal carcinoma. Alternative splicing leads to variants encoding two isoforms that differ in the C-terminal region. Mutations in this gene are associated with leukemia, lung, breast, bladder, pancreatic, and stomach cancer. (more)

Western blot Image
Anti-SLC35D3 / FRCL1 Antibody (C-Terminus) IHC-plus™ LS-B9577

LS-B9577 is a rabbit anti-SLC35D3 / FRCL1 polyclonal antibody approved for use in Enzyme-Linked Immunosorbent Assay, Immunocytochemistry, Immunofluorescence, Immunohistochemistry - Paraffin and Western blot.

About SLC35D3 / FRCL1: May play a role in hemostasis as a regulator of the biosynthesis of platelet-dense granules. (more)

Immunohistochemistry Image
Anti-Fgf15 Antibody (aa25-218) LS-C293897

LS-C293897 is a rabbit anti-Fgf15 polyclonal antibody approved for use in Enzyme-Linked Immunosorbent Assay and Western blot.

About Fgf15: Fibroblast growth factor 15 is a protein in mouse encoded by the Fgf15 gene. It is a member of the fibroblast growth factor (FGF) family but, like FGF19, FGF21 and FGF23, has endocrine functions. FGF19 is the orthologous protein in humans. They are often referred together as FGF15/19. (more)

Western blot Image
Anti-PLA2G2D Antibody (aa21-144) LS-C295912

LS-C295912 is a rabbit anti-PLA2G2D polyclonal antibody approved for use in Enzyme-Linked Immunosorbent Assay and Western blot.

About PLA2G2D: PLA2G2D is a secreted member of the phospholipase A2 family, and is found in a cluster of related family members on chromosome 1. Phospholipase A2 family members hydrolyze the sn-2 fatty acid ester bond of glycerophospholipids to produce lysophospholipids and free fatty acid. This gene may be involved in inflammation and immune response, and in weight loss associated with chronic obstructive pulmonary disease. Alternative splicing results in multiple transcript variants encoding different isoforms. (more)

Western blot Image
Anti-TIGIT Antibody (aa21-234) LS-C296579

LS-C296579 is a rabbit anti-TIGIT polyclonal antibody approved for use in Enzyme-Linked Immunosorbent Assay and Western blot.

About TIGIT: Binds with high affinity to the poliovirus receptor (PVR) which causes increased secretion of IL10 and decreased secretion of IL12B and suppresses T-cell activation by promoting the generation of mature immunoregulatory dendritic cells. (more)

Western blot Image
Anti-Lymphotoxin-Beta / LTB Antibody (aa58-304, FITC) LS-C301349

LS-C301349 is a Fluorescein rabbit anti-Lymphotoxin-Beta / LTB polyclonal antibody approved for use in Enzyme-Linked Immunosorbent Assay and Western blot.

About Lymphotoxin-Beta / LTB: Lymphotoxin beta is a type II membrane protein of the TNF family. It anchors lymphotoxin-alpha to the cell surface through heterotrimer formation. The predominant form on the lymphocyte surface is the lymphotoxin-alpha 1/beta 2 complex (e.g. 1 molecule alpha/2 molecules beta) and this complex is the primary ligand for the lymphotoxin-beta receptor. The minor complex is lymphotoxin-alpha 2/beta 1. LTB is an inducer of the inflammatory response system and involved in normal development of lymphoid tissue. Lymphotoxin-beta isoform b is unable to complex with lymphotoxin-alpha suggesting a function for lymphotoxin-beta which is independent of lympyhotoxin-alpha. Alternative splicing results in multiple transcript variants encoding different isoforms. (more)

Western blot Image
Anti-HHV-8 / HHV8 / KSHV Antibody (clone 13B10) LS-C312211

LS-C312211 is a mouse anti-HHV-8 / HHV8 / KSHV monoclonal antibody approved for use in Immunohistochemistry - Frozen and Immunohistochemistry - Paraffin. (more)

Immunohistochemistry Image
Anti-SATB2 Antibody (clone SATBA4B10) LS-C342331

LS-C342331 is a mouse anti-SATB2 monoclonal antibody approved for use in Dot Blot, Immunocytochemistry, Immunofluorescence, Immunoprecipitation and Western blot.

About SATB2: Binds to DNA, at nuclear matrix- or scaffold-associated regions. Thought to recognize the sugar-phosphate structure of double-stranded DNA. Transcription factor controlling nuclear gene expression, by binding to matrix attachment regions (MARs) of DNA and inducing a local chromatin-loop remodeling. Acts as a docking site for several chromatin remodeling enzymes and also by recruiting corepressors (HDACs) or coactivators (HATs) directly to promoters and enhancers. Required for the initiation of the upper-layer neurons (UL1) specific genetic program and for the inactivation of deep-layer neurons (DL) and UL2 specific genes, probably by modulating BCL11B expression. Repressor of Ctip2 and regulatory determinant of corticocortical connections in the developing cerebral cortex. (more)

Immunofluorescence Image
Anti-BACE1 / BACE Antibody (aa22-322) LS-C346301

LS-C346301 is a rabbit anti-BACE1 / BACE polyclonal antibody approved for use in Immunohistochemistry, Immunoprecipitation and Western blot.

About BACE1 / BACE: Responsible for the proteolytic processing of the amyloid precursor protein (APP). Cleaves at the N-terminus of the A-beta peptide sequence, between residues 671 and 672 of APP, leads to the generation and extracellular release of beta-cleaved soluble APP, and a corresponding cell-associated C-terminal fragment which is later released by gamma-secretase. (more)

Western blot Image
Anti-Hemoglobin Antibody IHC-plus™ LS-B12169

LS-B12169 is a rabbit anti-Hemoglobin polyclonal antibody approved for use in Enzyme-Linked Immunosorbent Assay, Immunohistochemistry - Paraffin and Western blot. (more)

Immunohistochemistry - Paraffin Image
Most Popular ELISA Kits
Human CTGF ELISA Kit (Sandwich ELISA) - LS-F557

LS-F557 is a 96-well enzyme-linked immunosorbent assay (ELISA) for the detection of Human CTGF in samples of Cell Lysates, Plasma and Serum. It is based upon a Sandwich assay principle and can be used to detect levels of CTGF as low as 63 picograms per milliliter.

About CTGF: Major connective tissue mitoattractant secreted by vascular endothelial cells. Promotes proliferation and differentiation of chondrocytes. Mediates heparin- and divalent cation-dependent cell adhesion in many cell types including fibroblasts, myofibroblasts, endothelial and epithelial cells. Enhances fibroblast growth factor-induced DNA synthesis. (more)

Mouse/Human Phospho-MYC / c-Myc (Ser62) ELISA Kit (DNA-Binding Phosphorylation ELISA) - LS-F886

LS-F886 is a 96-well enzyme-linked immunosorbent assay (ELISA) for the detection of Human MYC / c-Myc in samples of Cell Lysates and Nuclear Lysates. It is based upon a DNA Binding Phosphorylation assay principle.

About MYC / c-Myc: MYC / c-Myc is a multifunctional, nuclear phosphoprotein that plays a role in cell cycle progression, apoptosis and cellular transformation. It functions as a transcription factor that regulates transcription of specific target genes. Mutations, overexpression, rearrangement and translocation of this gene have been associated with a variety of hematopoietic tumors, leukemias and lymphomas, including Burkitt lymphoma. There is evidence to show that alternative translation initiations from an upstream, in-frame non-AUG (CUG) and a downstream AUG start site result in the production of two isoforms with distinct N-termini. The synthesis of non-AUG initiated protein is suppressed in Burkitt's lymphomas, suggesting its importance in the normal function of this gene. (more)

Human PLG / Plasmin / Plasminogen ELISA Kit (Sandwich ELISA) - LS-F2748

LS-F2748 is a 96-well enzyme-linked immunosorbent assay (ELISA) for the Quantitative detection of Human PLG / Plasmin / Plasminogen in samples of Cell Culture Supernatants, Plasma and Serum. It is based upon a Sandwich assay principle and can be used to detect levels of PLG / Plasmin / Plasminogen as low as 156 picograms per milliliter.

About PLG / Plasmin / Plasminogen: Plasmin dissolves the fibrin of blood clots and acts as a proteolytic factor in a variety of other processes including embryonic development, tissue remodeling, tumor invasion, and inflammation. In ovulation, weakens the walls of the Graafian follicle. It activates the urokinase-type plasminogen activator, collagenases and several complement zymogens, such as C1 and C5. Cleavage of fibronectin and laminin leads to cell detachment and apoptosis. Also cleaves fibrin, thrombospondin and von Willebrand factor. Its role in tissue remodeling and tumor invasion may be modulated by CSPG4. Binds to cells. (more)

Mouse REN / Renin 1 ELISA Kit (Sandwich ELISA) - LS-F2914

LS-F2914 is a 96-well enzyme-linked immunosorbent assay (ELISA) for the Quantitative detection of Mouse REN / Renin 1 in samples of Cell Culture Supernatants, Plasma and Serum. It is based upon a Sandwich assay principle and can be used to detect levels of REN / Renin 1 as low as 62.5 picograms per milliliter.

About REN / Renin 1: Renin catalyzes the first step in the activation pathway of angiotensinogen--a cascade that can result in aldosterone release,vasoconstriction, and increase in blood pressure. Renin, an aspartyl protease, cleaves angiotensinogen to form angiotensin I, which is converted to angiotensin II by angiotensin I converting enzyme, an important regulator of blood pressure and electrolyte balance. Transcript variants that encode different protein isoforms and that arise from alternative splicing and the use of alternative promoters have been described, but their full-length nature has not been determined. Mutations in this gene have been shown to cause familial hyperproreninemia. (more)

Mouse HMG1 / HMGB1 ELISA Kit (Sandwich ELISA) - LS-F4040

LS-F4040 is a 96-well enzyme-linked immunosorbent assay (ELISA) for the detection of Mouse HMG1 / HMGB1 in samples of Plasma and Serum. It is based upon a Sandwich assay principle and can be used to detect levels of HMG1 / HMGB1 as low as 46.88 picograms per milliliter.

About HMG1 / HMGB1: DNA binding proteins that associates with chromatin and has the ability to bend DNA. Binds preferentially single-stranded DNA. Involved in V(D)J recombination by acting as a cofactor of the RAG complex. Acts by stimulating cleavage and RAG protein binding at the 23 bp spacer of conserved recombination signal sequences (RSS). Heparin-binding protein that has a role in the extension of neurite-type cytoplasmic processes in developing cells. (more)

Mouse LPL / Lipoprotein Lipase ELISA Kit (Sandwich ELISA) - LS-F4201

LS-F4201 is a 96-well enzyme-linked immunosorbent assay (ELISA) for the detection of Mouse LPL / Lipoprotein Lipase in samples of Plasma, Serum and Tissue Homogenates. It is based upon a Sandwich assay principle and can be used to detect levels of LPL / Lipoprotein Lipase as low as 15.63 picograms per milliliter.

About LPL / Lipoprotein Lipase: The primary function of this lipase is the hydrolysis of triglycerides of circulating chylomicrons and very low density lipoproteins (VLDL). Binding to heparin sulfate proteogylcans at the cell surface is vital to the function. The apolipoprotein, APOC2, acts as a coactivator of LPL activity in the presence of lipids on the luminal surface of vascular endothelium. (more)

Mouse Complement C3a ELISA Kit (Sandwich ELISA) - LS-F4210

LS-F4210 is a 96-well enzyme-linked immunosorbent assay (ELISA) for the detection of Mouse Complement C3a in samples of Cell Culture Supernatants, Cell Lysates, Plasma, Serum and Tissue Homogenates. It is based upon a Sandwich assay principle and can be used to detect levels of Complement C3a as low as 15.63 picograms per milliliter.

About Complement C3a: C3a is one of the proteins formed by the cleavage of complement component 3; the other is C3b. C3a is a 77 residue peptide that binds to the C3a receptor (C3aR) a class A G protein-coupled receptor. It stimulates mast cell degranulation, thus triggering an immune response. C3a plays an important role in chemotaxis, though not as important a role as C5a. It is also an anaphylatoxin and the precursor of the important cytokine (adipokine) ASP through its interaction with carboxypeptidase B. Because C3a is rapidly degraded in serum, stable small molecule agonists and antagonists may be used as tools to probe the physiological effects of C3a in vivo. (more)

Human KRT18 / CK18 / Cytokeratin 18 ELISA Kit (Sandwich ELISA) - LS-F4491

LS-F4491 is a 96-well enzyme-linked immunosorbent assay (ELISA) for the detection of Human KRT18 / CK18 / Cytokeratin 18 in samples of Plasma, Serum and Tissue Homogenates. It is based upon a Sandwich assay principle and can be used to detect levels of KRT18 / CK18 / Cytokeratin 18 as low as 31.25 picograms per milliliter.

About KRT18 / CK18 / Cytokeratin 18: KRT18 encodes the type I intermediate filament chain keratin 18. Keratin 18, together with its filament partner keratin 8, are perhaps the most commonly found members of the intermediate filament gene family. They are expressed in single layer epithelial tissues of the body. Mutations in this gene have been linked to cryptogenic cirrhosis. (more)

Human TTR / Transthyretin ELISA Kit (Sandwich ELISA) - LS-F4655

LS-F4655 is a 96-well enzyme-linked immunosorbent assay (ELISA) for the detection of Human TTR / Transthyretin in samples of Cell Culture Supernatants, Cell Lysates, Cerebrospinal Fluid, Plasma, Serum and Tissue Homogenates. It is based upon a Sandwich assay principle and can be used to detect levels of TTR / Transthyretin as low as 0.313 nanograms per millilter.

About TTR / Transthyretin: TTR / Transthyretin is transthyretin, one of the three prealbumins including alpha-1-antitrypsin, transthyretin and orosomucoid. Transthyretin is a carrier protein; it transports thyroid hormones in the plasma and cerebrospinal fluid, and also transports retinol (vitamin A) in the plasma. The protein consists of a tetramer of identical subunits. More than 80 different mutations in this gene have been reported; most mutations are related to amyloid deposition, affecting predominantly peripheral nerve and/or the heart, and a small portion of the gene mutations is non-amyloidogenic. (more)

Mouse TXN / Thioredoxin / TRX ELISA Kit (Sandwich ELISA) - LS-F4705

LS-F4705 is a 96-well enzyme-linked immunosorbent assay (ELISA) for the detection of Mouse TXN / Thioredoxin / TRX in samples of Plasma, Serum and Tissue Homogenates. It is based upon a Sandwich assay principle and can be used to detect levels of TXN / Thioredoxin / TRX as low as 31.25 picograms per milliliter.

About TXN / Thioredoxin / TRX: Participates in various redox reactions through the reversible oxidation of its active center dithiol to a disulfide and catalyzes dithiol-disulfide exchange reactions. Plays a role in the reversible S-nitrosylation of cysteine residues in target proteins, and thereby contributes to the response to intracellular nitric oxide. Nitrosylates the active site Cys of CASP3 in response to nitric oxide (NO), and thereby inhibits caspase-3 activity. Induces the FOS/JUN AP-1 DNA-binding activity in ionizing radiation (IR) cells through its oxidation/reduction status and stimulates AP-1 transcriptional activity.ADF augments the expression of the interleukin-2 receptor TAC (IL2R/P55). (more)

Human TGM2 / Transglutaminase 2 ELISA Kit (Sandwich ELISA) - LS-F5009

LS-F5009 is a 96-well enzyme-linked immunosorbent assay (ELISA) for the detection of Human TGM2 / Transglutaminase 2 in samples of Plasma, Serum and Tissue Homogenates. It is based upon a Sandwich assay principle and can be used to detect levels of TGM2 / Transglutaminase 2 as low as 0.156 nanograms per millilter.

About TGM2 / Transglutaminase 2: Transglutaminases are enzymes that catalyze the crosslinking of proteins by epsilon-gamma glutamyl lysine isopeptide bonds. While the primary structure of transglutaminases is not conserved, they all have the same amino acid sequence at their active sites and their activity is calcium-dependent. The protein encoded by this gene acts as a monomer, is induced by retinoic acid, and appears to be involved in apoptosis. Finally, the encoded protein is the autoantigen implicated in celiac disease. Two transcript variants encoding different isoforms have been found for this gene. (more)

Human BAFF Receptor ELISA Kit (Sandwich ELISA) - LS-F5237

LS-F5237 is a 96-well enzyme-linked immunosorbent assay (ELISA) for the detection of Human BAFF Receptor in samples of Cell Lysates and Tissue Homogenates. It is based upon a Sandwich assay principle and can be used to detect levels of BAFF Receptor as low as 0.056 nanograms per millilter.

About BAFF Receptor: B cell-activating factor (BAFF) enhances B-cell survival in vitro and is a regulator of the peripheral B-cell population. Overexpression of Baff in mice results in mature B-cell hyperplasia and symptoms of systemic lupus erythematosus (SLE). Also, some SLE patients have increased levels of BAFF in serum. Therefore, it has been proposed that abnormally high levels of BAFF may contribute to the pathogenesis of autoimmune diseases by enhancing the survival of autoreactive B cells. The protein encoded by this gene is a receptor for BAFF and is a type III transmembrane protein containing a single extracellular cysteine-rich domain. It is thought that this receptor is the principal receptor required for BAFF-mediated mature B-cell survival. (more)

Guinea pig TNF Alpha ELISA Kit (Sandwich ELISA) - LS-F5322

LS-F5322 is a 96-well enzyme-linked immunosorbent assay (ELISA) for the detection of Guinea pig TNF Alpha in samples of Cell Culture Supernatants, Cell Lysates, Plasma, Serum and Tissue Homogenates. It is based upon a Sandwich assay principle and can be used to detect levels of TNF Alpha as low as 7.8 picograms per milliliter.

About TNF Alpha: TNF Alpha is a multifunctional proinflammatory cytokine that belongs to the tumor necrosis factor (TNF) superfamily. This cytokine is mainly secreted by macrophages. It can bind to, and thus functions through its receptors TNFRSF1A/TNFR1 and TNFRSF1B/TNFBR. This cytokine is involved in the regulation of a wide spectrum of biological processes including cell proliferation, differentiation, apoptosis, lipid metabolism, and coagulation. This cytokine has been implicated in a variety of diseases, including autoimmune diseases, insulin resistance, and cancer. Knockout studies in mice also suggested the neuroprotective function of this cytokine. (more)

Human SOD1 / Cu-Zn SOD ELISA Kit (Sandwich ELISA) - LS-F5770

LS-F5770 is a 96-well enzyme-linked immunosorbent assay (ELISA) for the detection of Human SOD1 / Cu-Zn SOD in samples of Plasma, Serum and Tissue Homogenates. It is based upon a Sandwich assay principle and can be used to detect levels of SOD1 / Cu-Zn SOD as low as 62.5 picograms per milliliter.

About SOD1 / Cu-Zn SOD: SOD1 / Cu-Zn SOD binds copper and zinc ions and is one of two isozymes responsible for destroying free superoxide radicals in the body. The encoded isozyme is a soluble cytoplasmic protein, acting as a homodimer to convert naturally-occuring but harmful superoxide radicals to molecular oxygen and hydrogen peroxide. The other isozyme is a mitochondrial protein. Mutations in this gene have been implicated as causes of familial amyotrophic lateral sclerosis. Rare transcript variants have been reported for this gene. (more)

Mouse/Human/Rat NOG / Noggin ELISA Kit (Sandwich ELISA) - LS-F5920

LS-F5920 is a 96-well enzyme-linked immunosorbent assay (ELISA) for the detection of Human NOG / Noggin in samples of Cell Culture Supernatants, Cell Lysates, Plasma, Serum and Tissue Homogenates. It is based upon a Sandwich assay principle and can be used to detect levels of NOG / Noggin as low as 0.156 nanograms per millilter.

About NOG / Noggin: The secreted polypeptide, encoded by this gene, binds and inactivates members of the transforming growth factor-beta (TGF-beta) superfamily signaling proteins, such as bone morphogenetic protein-4 (BMP4). By diffusing through extracellular matrices more efficiently than members of the TGF-beta superfamily, this protein may have a principal role in creating morphogenic gradients. The protein appears to have pleiotropic effect, both early in development as well as in later stages. It was originally isolated from Xenopus based on its ability to restore normal dorsal-ventral body axis in embryos that had been artificially ventralized by UV treatment. (more)

Pig Trypsin ELISA Kit (Sandwich ELISA) - LS-F6198

LS-F6198 is a 96-well enzyme-linked immunosorbent assay (ELISA) for the detection of Pig Trypsin in samples of Cell Culture Supernatants, Cell Lysates, Plasma, Serum and Tissue Homogenates. It is based upon a Sandwich assay principle and can be used to detect levels of Trypsin as low as 1.56 nanograms per millilter.

About Trypsin: Trypsin is a serine protease found in the digestive system of many vertebrates, where it hydrolyses proteins. Trypsin is produced in the pancreas as the inactive protease trypsinogen, which is encoded by several genes (PRSS1, PRSS2, PRSS3). Trypsin cleaves peptide chains mainly at the carboxyl side of the amino acids lysine or arginine, except when either is followed by proline. (more)

Human TJP1 / ZO-1 ELISA Kit (Sandwich ELISA) - LS-F6434

LS-F6434 is a 96-well enzyme-linked immunosorbent assay (ELISA) for the detection of Human TJP1 / ZO-1 in samples of Cell Lysates and Tissue Homogenates. It is based upon a Sandwich assay principle and can be used to detect levels of TJP1 / ZO-1 as low as 0.156 nanograms per millilter.

About TJP1 / ZO-1: The N-terminal may be involved in transducing a signal required for tight junction assembly, while the C-terminal may have specific properties of tight junctions. The alpha domain might be involved in stabilizing junctions. Plays a role in the regulation of cell migration by targeting CDC42BPB to the leading edge of migrating cells. (more)

Bovine Fibrinogen ELISA Kit (Sandwich ELISA) - LS-F6449

LS-F6449 is a 96-well enzyme-linked immunosorbent assay (ELISA) for the detection of Bovine Fibrinogen in samples of Plasma. It is based upon a Sandwich assay principle and can be used to detect levels of Fibrinogen as low as 39 nanograms per millilter.

About Fibrinogen: Fibrinogen (factor I) is a glycoprotein in vertebrates that helps in the formation of blood clots. It consists of a linear array of three nodules held together by a very thin thread which is estimated to have a diameter between 8 and 15 Angstrom (Å). The two end nodules are alike but the center one is slightly smaller. Measurements of shadow lengths indicate that nodule diameters are in the range 50 to 70 Angstrom. The length of the dried molecule is 475 ± 25 Angstrom. The fibrinogen molecule is a soluble, large, and complex glycoprotein, 340 kDa plasma glycoprotein, that is converted by thrombin into fibrin during blood clot formation. It has a rod-like shape with dimensions of 9 × 47.5 × 6 nm and it shows a negative net charge at physiological pH (IP at pH 5.2). (more)

Human GLP2 ELISA Kit (Competitive EIA) - LS-F6546

LS-F6546 is a 96-well enzyme-linked immunosorbent assay (ELISA) for the detection of Human GLP2 in samples of Cell Culture Supernatants, Cell Lysates, Plasma, Serum and Tissue Homogenates. It is based upon a Competitive EIA assay principle and can be used to detect levels of GLP2 as low as 123.46 picograms per milliliter.

About GLP2: Glucagon-like peptide-2 (GLP-2) is a 33 amino acid peptide with the sequence HADGSFSDEMNTILDNLAARDFINWLIQTKITD in humans. GLP-2 is created by specific post-translational proteolytic cleavage of proglucagon in a process that also liberates the related glucagon-like peptide-1 (GLP-1). GLP-2 is produced by the intestinal endocrine L cell and by various neurons in the central nervous system. Intestinal GLP-2 is co-secreted along with GLP-1 upon nutrient ingestion. (more)

Human GAA / Alpha-Glucosidase, Acid ELISA Kit (Sandwich ELISA) - LS-F7547

LS-F7547 is a 96-well enzyme-linked immunosorbent assay (ELISA) for the detection of Human GAA / Alpha-Glucosidase, Acid in samples of Cell Lysates and Tissue Homogenates. It is based upon a Sandwich assay principle and can be used to detect levels of GAA / Alpha-Glucosidase, Acid as low as 0.625 nanograms per millilter.

About GAA / Alpha-Glucosidase, Acid: GAA / Alpha-Glucosidase, Acid is acid alpha-glucosidase, which is essential for the degradation of glycogen to glucose in lysosomes. Different forms of acid alpha-glucosidase are obtained by proteolytic processing. Defects in this gene are the cause of glycogen storage disease II, also known as Pompe's disease, which is an autosomal recessive disorder with a broad clinical spectrum. Three transcript variants encoding the same protein have been found for this gene. (more)

Human COL15A1 / Collagen XV Alpha 1 ELISA Kit (Sandwich ELISA) - LS-F7575

LS-F7575 is a 96-well enzyme-linked immunosorbent assay (ELISA) for the detection of Human COL15A1 / Collagen XV Alpha 1 in samples of Plasma, Serum and Tissue Homogenates. It is based upon a Sandwich assay principle and can be used to detect levels of COL15A1 / Collagen XV Alpha 1 as low as 3.13 nanograms per millilter.

About COL15A1 / Collagen XV Alpha 1: COL15A1 / Collagen XV Alpha 1 is the alpha chain of type XV collagen, a member of the FACIT collagen family (fibril-associated collagens with interrupted helices). Type XV collagen has a wide tissue distribution but the strongest expression is localized to basement membrane zones so it may function to adhere basement membranes to underlying connective tissue stroma. The proteolytically produced C-terminal fragment of type XV collagen is restin, a potentially antiangiogenic protein that is closely related to endostatin. Mouse studies have shown that collagen XV deficiency is associated with muscle and microvessel deterioration. (more)

Human TAGLN / Transgelin / SM22 ELISA Kit (Sandwich ELISA) - LS-F7946

LS-F7946 is a 96-well enzyme-linked immunosorbent assay (ELISA) for the detection of Human TAGLN / Transgelin / SM22 in samples of Plasma, Serum and Tissue Homogenates. It is based upon a Sandwich assay principle and can be used to detect levels of TAGLN / Transgelin / SM22 as low as 0.156 nanograms per millilter.

About TAGLN / Transgelin / SM22: TAGLN / Transgelin / SM22 is a transformation and shape-change sensitive actin cross-linking/gelling protein found in fibroblasts and smooth muscle. Its expression is down-regulated in many cell lines, and this down-regulation may be an early and sensitive marker for the onset of transformation. A functional role of this protein is unclear. Two transcript variants encoding the same protein have been found for this gene. (more)

Mouse LL37 / Cathelicidin ELISA Kit (Sandwich ELISA) - LS-F9642

LS-F9642 is a 96-well enzyme-linked immunosorbent assay (ELISA) for the detection of Mouse LL37 / Cathelicidin in samples of Cell Culture Supernatants, Cell Lysates, Plasma, Serum and Tissue Homogenates. It is based upon a Sandwich assay principle and can be used to detect levels of LL37 / Cathelicidin as low as 0.78 nanograms per millilter.

About LL37 / Cathelicidin: LL37 / Cathelicidin is a member of an antimicrobial peptide family, characterized by a highly conserved N-terminal signal peptide containing a cathelin domain and a structurally variable cationic antimicrobial peptide, which is produced by extracellular proteolysis from the C-terminus. In addition to its antibacterial, antifungal, and antiviral activities, the encoded protein functions in cell chemotaxis, immune mediator induction, and inflammatory response regulation. (more)

Mouse CD33 ELISA Kit (Sandwich ELISA) - LS-F9886

LS-F9886 is a 96-well enzyme-linked immunosorbent assay (ELISA) for the detection of Mouse CD33 in samples of Cell Lysates and Tissue Homogenates. It is based upon a Sandwich assay principle and can be used to detect levels of CD33 as low as 0.156 nanograms per millilter.

About CD33: Putative adhesion molecule of myelomonocytic-derived cells that mediates sialic-acid dependent binding to cells. Preferentially binds to alpha-2,6-linked sialic acid. The sialic acid recognition site may be masked by cis interactions with sialic acids on the same cell surface. In the immune response, may act as an inhibitory receptor upon ligand induced tyrosine phosphorylation by recruiting cytoplasmic phosphatase(s) via their SH2 domain(s) that block signal transduction through dephosphorylation of signaling molecules. Induces apoptosis in acute myeloid leukemia (in vitro). (more)

Human Anti-Hepatitis A virus antibody (IgG) ELISA Kit (Competitive EIA) - LS-F10238

LS-F10238 is a 96-well enzyme-linked immunosorbent assay (ELISA) for the detection of Human Anti-Hepatitis A virus antibody (IgG) in samples of Serum. It is based upon a Competitive EIA assay principle. (more)

Human IgG Fc ELISA Kit (Sandwich ELISA) - LS-F10602

LS-F10602 is a 96-well enzyme-linked immunosorbent assay (ELISA) for the Quantitative detection of Human Human IgG Fc in samples of Cell Culture Supernatants, Plasma, Serum and Tissue Homogenates. It is based upon a Sandwich assay principle and can be used to detect levels of Human IgG Fc as low as 1.56 nanograms per millilter.

About Human IgG Fc: The fragment crystallizable region (Fc region) is the tail region of an antibody that interacts with cell surface receptors called Fc receptors and some proteins of the complement system. This property allows antibodies to activate the immune system. In IgG, IgA and IgD antibody isotypes, the Fc region is composed of two identical protein fragments, derived from the second and third constant domains of the antibody's two heavy chains; IgM and IgE Fc regions contain three heavy chain constant domains (CH domains 2–4) in each polypeptide chain. The Fc regions of IgGs bear a highly conserved N-glycosylation site. Glycosylation of the Fc fragment is essential for Fc receptor-mediated activity. (more)

IP3 / Inositol Trisphosphate ELISA Kit (Competitive EIA) - LS-F10644

LS-F10644 is a 96-well enzyme-linked immunosorbent assay (ELISA) for the Quantitative detection of IP3 / Inositol Trisphosphate in samples of Cell Culture Supernatants, Plasma, Serum and Tissue Homogenates. It is based upon a Competitive EIA assay principle and can be used to detect levels of IP3 / Inositol Trisphosphate as low as 0.625 nanograms per millilter. (more)

Human YWHAQ / 14-3-3 Theta ELISA Kit (Sandwich ELISA) - LS-F10677

LS-F10677 is a 96-well enzyme-linked immunosorbent assay (ELISA) for the Quantitative detection of Human YWHAQ / 14-3-3 Theta in samples of Cell Culture Supernatants, Plasma, Serum and Tissue Homogenates. It is based upon a Sandwich assay principle and can be used to detect levels of YWHAQ / 14-3-3 Theta as low as 0.78 nanograms per millilter.

About YWHAQ / 14-3-3 Theta: Adapter protein implicated in the regulation of a large spectrum of both general and specialized signaling pathways. Binds to a large number of partners, usually by recognition of a phosphoserine or phosphothreonine motif. Binding generally results in the modulation of the activity of the binding partner. Negatively regulates the kinase activity of PDPK1. (more)

Human ADM / Adrenomedullin ELISA Kit (Sandwich ELISA) - LS-F10754

LS-F10754 is a 96-well enzyme-linked immunosorbent assay (ELISA) for the Quantitative detection of Human ADM / Adrenomedullin in samples of Cell Culture Supernatants, Plasma, Serum and Tissue Homogenates. It is based upon a Sandwich assay principle and can be used to detect levels of ADM / Adrenomedullin as low as 15.6 picograms per milliliter.

About ADM / Adrenomedullin: Adrenomedullin, a hypotensive peptide found in human pheochromocytoma, consists of 52 amino acids, has 1 intramolecular disulfide bond, and shows a slight homology with the calcitonin gene-related peptide. It may function as a hormone in circulation control because it is found in blood in a considerable concentration. The precursor, called preproadrenomedullin, is 185 amino acids long. By RNA-blot analysis, human adrenomedullin mRNA was found to be highly expressed in several tissues. Genomic ADM DNA consists of 4 exons and 3 introns, with the 5-prime flanking region containing TATA, CAAT, and GC boxes. There are also multiple binding sites for activator protein-2 and a cAMP-regulated enhancer element. (more)

Mouse ANGPTL4 ELISA Kit (Sandwich ELISA) - LS-F10824

LS-F10824 is a 96-well enzyme-linked immunosorbent assay (ELISA) for the Quantitative detection of Mouse ANGPTL4 in samples of Cell Culture Supernatants, Plasma, Serum and Tissue Homogenates. It is based upon a Sandwich assay principle and can be used to detect levels of ANGPTL4 as low as 78 picograms per milliliter.

About ANGPTL4: Protein with hypoxia-induced expression in endothelial cells. May act as a regulator of angiogenesis and modulate tumorigenesis. Inhibits proliferation, migration, and tubule formation of endothelial cells and reduces vascular leakage. May exert a protective function on endothelial cells through an endocrine action. It is directly involved in regulating glucose homeostasis, lipid metabolism, and insulin sensitivity. In response to hypoxia, the unprocessed form of the protein accumulates in the subendothelial extracellular matrix (ECM). The matrix-associated and immobilized unprocessed form limits the formation of actin stress fibers and focal contacts in the adhering endothelial cells and inhibits their adhesion. (more)

Human ANGPTL7 / CDT6 ELISA Kit (Sandwich ELISA) - LS-F10825

LS-F10825 is a 96-well enzyme-linked immunosorbent assay (ELISA) for the Quantitative detection of Human ANGPTL7 / CDT6 in samples of Cell Culture Supernatants, Plasma, Serum and Tissue Homogenates. It is based upon a Sandwich assay principle and can be used to detect levels of ANGPTL7 / CDT6 as low as 78 picograms per milliliter. (more)

Human ASS1 / ASS ELISA Kit (Sandwich ELISA) - LS-F10890

LS-F10890 is a 96-well enzyme-linked immunosorbent assay (ELISA) for the Quantitative detection of Human ASS1 / ASS in samples of Cell Culture Supernatants, Plasma, Serum and Tissue Homogenates. It is based upon a Sandwich assay principle and can be used to detect levels of ASS1 / ASS as low as 0.156 nanograms per millilter.

About ASS1 / ASS: Arginosuccinate synthetase catalyzes the penultimate step of the arginine biosynthetic pathway. There are approximately 10 to 14 ASS pseudogenes scattered across the human genome; the ASS gene located on chromosome 9 appears to be the only functional gene for argininosuccinate synthetase. The ASS primary transcript is subject to alternative splicing in the 5' non-coding region; a splice variant lacking exon 2 occurs in liver and fibroblast cells. Mutations in the chromosome 9 copy of ASS cause citrullinemia. (more)

Human CD68 ELISA Kit (Sandwich ELISA) - LS-F11094

LS-F11094 is a 96-well enzyme-linked immunosorbent assay (ELISA) for the Quantitative detection of Human CD68 in samples of Cell Culture Supernatants, Plasma, Serum and Tissue Homogenates. It is based upon a Sandwich assay principle and can be used to detect levels of CD68 as low as 0.312 nanograms per millilter.

About CD68: CD68 is a 110-kD transmembrane glycoprotein that is highly expressed by human monocytes and tissue macrophages. It is a member of the lysosomal/endosomal-associated membrane glycoprotein (LAMP) family. The protein primarily localizes to lysosomes and endosomes with a smaller fraction circulating to the cell surface. It is a type I integral membrane protein with a heavily glycosylated extracellular domain and binds to tissue- and organ-specific lectins or selectins. The protein is also a member of the scavenger receptor family. Scavenger receptors typically function to clear cellular debris, promote phagocytosis, and mediate the recruitment and activation of macrophages. Alternative splicing results in multiple transcripts encoding different isoforms. (more)

Mouse Chil3 / Chi3l3 ELISA Kit (Sandwich ELISA) - LS-F11125

LS-F11125 is a 96-well enzyme-linked immunosorbent assay (ELISA) for the Quantitative detection of Mouse Chil3 / Chi3l3 in samples of Cell Culture Supernatants, Plasma, Serum and Tissue Homogenates. It is based upon a Sandwich assay principle and can be used to detect levels of Chil3 / Chi3l3 as low as 78 picograms per milliliter. (more)

Human FKBP5 / FKBP51 ELISA Kit (Sandwich ELISA) - LS-F11476

LS-F11476 is a 96-well enzyme-linked immunosorbent assay (ELISA) for the Quantitative detection of Human FKBP5 / FKBP51 in samples of Cell Culture Supernatants, Plasma, Serum and Tissue Homogenates. It is based upon a Sandwich assay principle and can be used to detect levels of FKBP5 / FKBP51 as low as 0.156 nanograms per millilter.

About FKBP5 / FKBP51: FKBP5 / FKBP51 is a member of the immunophilin protein family, which play a role in immunoregulation and basic cellular processes involving protein folding and trafficking. This encoded protein is a cis-trans prolyl isomerase that binds to the immunosuppressants FK506 and rapamycin. It is thought to mediate calcineurin inhibition. It also interacts functionally with mature hetero-oligomeric progesterone receptor complexes along with the 90 kDa heat shock protein and P23 protein. This gene has been found to have multiple polyadenylation sites. Alternative splicing results in multiple transcript variants. (more)

Human GAPDH ELISA Kit (Sandwich ELISA) - LS-F11503

LS-F11503 is a 96-well enzyme-linked immunosorbent assay (ELISA) for the Quantitative detection of Human GAPDH in samples of Cell Culture Supernatants, Plasma, Serum and Tissue Homogenates. It is based upon a Sandwich assay principle and can be used to detect levels of GAPDH as low as 0.15 nanograms per millilter.

About GAPDH: Has both glyceraldehyde-3-phosphate dehydrogenase and nitrosylase activities, thereby playing a role in glycolysis and nuclear functions, respectively. Participates in nuclear events including transcription, RNA transport, DNA replication and apoptosis. Nuclear functions are probably due to the nitrosylase activity that mediates cysteine S-nitrosylation of nuclear target proteins such as SIRT1, HDAC2 and PRKDC. Modulates the organization and assembly of the cytoskeleton. Facilitates the CHP1-dependent microtubule and membrane associations through its ability to stimulate the binding of CHP1 to microtubules (By similarity). (more)

Mouse HAMP / Hepcidin ELISA Kit (Sandwich ELISA) - LS-F11620

LS-F11620 is a 96-well enzyme-linked immunosorbent assay (ELISA) for the Quantitative detection of Mouse HAMP / Hepcidin in samples of Cell Culture Supernatants, Plasma, Serum and Tissue Homogenates. It is based upon a Sandwich assay principle and can be used to detect levels of HAMP / Hepcidin as low as 6.25 picograms per milliliter.

About HAMP / Hepcidin: Liver-produced hormone that constitutes the main circulating regulator of iron absorption and distribution across tissues. Acts by promoting endocytosis and degradation of ferroportin, leading to the retention of iron in iron-exporting cells and decreased flow of iron into plasma. Controls the major flows of iron into plasma: absorption of dietary iron in the intestine, recycling of iron by macrophages, which phagocytose old erythrocytes and other cells, and mobilization of stored iron from hepatocytes (PubMed:22306005). (more)

Human HLA-G ELISA Kit (Sandwich ELISA) - LS-F11636

LS-F11636 is a 96-well enzyme-linked immunosorbent assay (ELISA) for the Quantitative detection of Human HLA-G in samples of Cell Culture Supernatants, Plasma, Serum and Tissue Homogenates. It is based upon a Sandwich assay principle and can be used to detect levels of HLA-G as low as 0.312 nanograms per millilter.

About HLA-G: HLA-G belongs to the HLA class I heavy chain paralogues. This class I molecule is a heterodimer consisting of a heavy chain and a light chain (beta-2 microglobulin). The heavy chain is anchored in the membrane. HLA-G is expressed on fetal derived placental cells. The heavy chain is approximately 45 kDa and its gene contains 8 exons. Exon one encodes the leader peptide, exons 2 and 3 encode the alpha1 and alpha2 domain, which both bind the peptide, exon 4 encodes the alpha3 domain, exon 5 encodes the transmembrane region, and exon 6 encodes the cytoplasmic tail. (more)

Human Mucin 2 / MUC2 ELISA Kit (Sandwich ELISA) - LS-F12102

LS-F12102 is a 96-well enzyme-linked immunosorbent assay (ELISA) for the Quantitative detection of Human Mucin 2 / MUC2 in samples of Cell Culture Supernatants, Plasma, Serum and Tissue Homogenates. It is based upon a Sandwich assay principle and can be used to detect levels of Mucin 2 / MUC2 as low as 0.156 nanograms per millilter.

About Mucin 2 / MUC2: Mucin 2 / MUC2 is a member of the mucin protein family. Mucins are high molecular weight glycoproteins produced by many epithelial tissues. The protein encoded by this gene is secreted and forms an insoluble mucous barrier that protects the gut lumen. The protein polymerizes into a gel of which 80% is composed of oligosaccharide side chains by weight. The protein features a central domain containing tandem repeats rich in threonine and proline that varies between 50 and 115 copies in different individuals. Alternatively spliced transcript variants of this gene have been described, but their full-length nature is not known. (more)

Human NOS2 / iNOS ELISA Kit (Sandwich ELISA) - LS-F12167

LS-F12167 is a 96-well enzyme-linked immunosorbent assay (ELISA) for the Quantitative detection of Human NOS2 / iNOS in samples of Cell Culture Supernatants, Plasma, Serum and Tissue Homogenates. It is based upon a Sandwich assay principle and can be used to detect levels of NOS2 / iNOS as low as 15.6 picograms per milliliter.

About NOS2 / iNOS: Produces nitric oxide (NO) which is a messenger molecule with diverse functions throughout the body. In macrophages, NO mediates tumoricidal and bactericidal actions. Also has nitrosylase activity and mediates cysteine S-nitrosylation of cytoplasmic target proteins such COX2. (more)

Human OCLN / Occludin ELISA Kit (Sandwich ELISA) - LS-F12208

LS-F12208 is a 96-well enzyme-linked immunosorbent assay (ELISA) for the Quantitative detection of Human OCLN / Occludin in samples of Cell Culture Supernatants, Plasma, Serum and Tissue Homogenates. It is based upon a Sandwich assay principle and can be used to detect levels of OCLN / Occludin as low as 0.156 nanograms per millilter.

About OCLN / Occludin: OCLN / Occludin is an integral membrane protein that is required for cytokine-induced regulation of the tight junction paracellular permeability barrier. Mutations in this gene are thought to be a cause of band-like calcification with simplified gyration and polymicrogyria (BLC-PMG), an autosomal recessive neurologic disorder that is also known as pseudo-TORCH syndrome. Alternative splicing results in multiple transcript variants. A related pseudogene is present 1.5 Mb downstream on the q arm of chromosome 5. (more)

Mouse SFTPC / Surfactant Protein C ELISA Kit (Sandwich ELISA) - LS-F12439

LS-F12439 is a 96-well enzyme-linked immunosorbent assay (ELISA) for the Quantitative detection of Mouse SFTPC / Surfactant Protein C in samples of Cell Culture Supernatants, Plasma, Serum and Tissue Homogenates. It is based upon a Sandwich assay principle and can be used to detect levels of SFTPC / Surfactant Protein C as low as 0.39 nanograms per millilter.

About SFTPC / Surfactant Protein C: SFTPC / Surfactant Protein C is the pulmonary-associated surfactant protein C (SPC), an extremely hydrophobic surfactant protein essential for lung function and homeostasis after birth. Pulmonary surfactant is a surface-active lipoprotein complex composed of 90% lipids and 10% proteins which include plasma proteins and apolipoproteins SPA, SPB, SPC and SPD. The surfactant is secreted by the alveolar cells of the lung and maintains the stability of pulmonary tissue by reducing the surface tension of fluids that coat the lung. (more)

Human RELN / Reelin ELISA Kit (Sandwich ELISA) - LS-F12487

LS-F12487 is a 96-well enzyme-linked immunosorbent assay (ELISA) for the Quantitative detection of Human RELN / Reelin in samples of Cell Culture Supernatants, Plasma, Serum and Tissue Homogenates. It is based upon a Sandwich assay principle and can be used to detect levels of RELN / Reelin as low as 15.6 picograms per milliliter.

About RELN / Reelin: Extracellular matrix serine protease that plays a role in layering of neurons in the cerebral cortex and cerebellum. Regulates microtubule function in neurons and neuronal migration. Affects migration of sympathetic preganglionic neurons in the spinal cord, where it seems to act as a barrier to neuronal migration. Enzymatic activity is important for the modulation of cell adhesion. Binding to the extracellular domains of lipoprotein receptors VLDLR and LRP8/APOER2 induces tyrosine phosphorylation of DAB1 and modulation of TAU phosphorylation. (more)

Mouse SST / Somatostatin ELISA Kit (Sandwich ELISA) - LS-F12622

LS-F12622 is a 96-well enzyme-linked immunosorbent assay (ELISA) for the Quantitative detection of Mouse SST / Somatostatin in samples of Cell Culture Supernatants, Plasma, Serum and Tissue Homogenates. It is based upon a Sandwich assay principle and can be used to detect levels of SST / Somatostatin as low as 7.8 picograms per milliliter.

About SST / Somatostatin: The hormone somatostatin has active 14 aa and 28 aa forms that are produced by alternate cleavage of the single preproprotein encoded by this gene. Somatostatin is expressed throughout the body and inhibits the release of numerous secondary hormones by binding to high-affinity G-protein-coupled somatostatin receptors. This hormone is an important regulator of the endocrine system through its interactions with pituitary growth hormone, thyroid stimulating hormone, and most hormones of the gastrointestinal tract. Somatostatin also affects rates of neurotransmission in the central nervous system and proliferation of both normal and tumorigenic cells. (more)

Mouse TNNT2 / CTNT ELISA Kit (Sandwich ELISA) - LS-F12813

LS-F12813 is a 96-well enzyme-linked immunosorbent assay (ELISA) for the Quantitative detection of Mouse TNNT2 / CTNT in samples of Cell Culture Supernatants, Plasma, Serum and Tissue Homogenates. It is based upon a Sandwich assay principle and can be used to detect levels of TNNT2 / CTNT as low as 7.8 picograms per milliliter.

About TNNT2 / CTNT: TNNT2 / CTNT is the tropomyosin-binding subunit of the troponin complex, which is located on the thin filament of striated muscles and regulates muscle contraction in response to alterations in intracellular calcium ion concentration. Mutations in this gene have been associated with familial hypertrophic cardiomyopathy as well as with dilated cardiomyopathy. Transcripts for this gene undergo alternative splicing that results in many tissue-specific isoforms, however, the full-length nature of some of these variants has not yet been determined. (more)

Mouse F11 / FXI / Factor XI ELISA Kit (Sandwich ELISA) - LS-F13175

LS-F13175 is a 96-well enzyme-linked immunosorbent assay (ELISA) for the Quantitative detection of Mouse F11 / FXI / Factor XI in samples of Cell Culture Supernatants, Plasma, Serum and Tissue Homogenates. It is based upon a Sandwich assay principle and can be used to detect levels of F11 / FXI / Factor XI as low as 0.156 nanograms per millilter.

About F11 / FXI / Factor XI: F11 / FXI / Factor XI is coagulation factor XI of the blood coagulation cascade. This protein is present in plasma as a zymogen, which is a unique plasma coagulation enzyme because it exists as a homodimer consisting of two identical polypeptide chains linked by disulfide bonds. During activation of the plasma factor XI, an internal peptide bond is cleaved by factor XIIa (or XII) in each of the two chains, resulting in activated factor XIa, a serine protease composed of two heavy and two light chains held together by disulfide bonds. This activated plasma factor XI triggers the middle phase of the intrisic pathway of blood coagulation by activating factor IX. Defects in this factor lead to Rosenthal syndrome, a blood coagulation abnormality. (more)

Mouse CKM / Creatine Kinase MM ELISA Kit (Sandwich ELISA) - LS-F13284

LS-F13284 is a 96-well enzyme-linked immunosorbent assay (ELISA) for the Quantitative detection of Mouse CKM / Creatine Kinase MM in samples of Cell Culture Supernatants, Plasma, Serum and Tissue Homogenates. It is based upon a Sandwich assay principle and can be used to detect levels of CKM / Creatine Kinase MM as low as 0.312 nanograms per millilter.

About CKM / Creatine Kinase MM: Reversibly catalyzes the transfer of phosphate between ATP and various phosphogens (e.g. creatine phosphate). Creatine kinase isoenzymes play a central role in energy transduction in tissues with large, fluctuating energy demands, such as skeletal muscle, heart, brain and spermatozoa. (more)

Mouse B2M / Beta 2 Microglobulin ELISA Kit (Sandwich ELISA) - LS-F14141

LS-F14141 is a 96-well enzyme-linked immunosorbent assay (ELISA) for the detection of Mouse B2M / Beta 2 Microglobulin in samples of Cell Culture Supernatants, Plasma, Serum and Tissue Homogenates. It is based upon a Sandwich assay principle and can be used to detect levels of B2M / Beta 2 Microglobulin as low as 0.78 nanograms per millilter.

About B2M / Beta 2 Microglobulin: B2M / Beta 2 Microglobulin is a serum protein found in association with the major histocompatibility complex (MHC) class I heavy chain on the surface of nearly all nucleated cells. The protein has a predominantly beta-pleated sheet structure that can form amyloid fibrils in some pathological conditions. The encoded antimicrobial protein displays antibacterial activity in amniotic fluid. A mutation in this gene has been shown to result in hypercatabolic hypoproteinemia. (more)

Gram Negative Endotoxin ELISA Kit (Sandwich ELISA) (Custom) - LS-F15272

LS-F15272 is a 96-well enzyme-linked immunosorbent assay (ELISA) for the detection of Gram Negative Endotoxin. It is based upon a Sandwich assay principle.

About Gram Negative Endotoxin: Lipopolysaccharides (LPS), also known as lipoglycans and endotoxin, are large molecules consisting of a lipid and a polysaccharide composed of O-antigen, outer core and inner core joined by a covalent bond; they are found in the outer membrane of Gram-negative bacteria, and elicit strong immune responses in animals. (more)

Mouse TPSAB1 / Mast Cell Tryptase ELISA Kit (Sandwich ELISA) - LS-F15881

LS-F15881 is a 96-well enzyme-linked immunosorbent assay (ELISA) for the detection of Mouse TPSAB1 / Mast Cell Tryptase in samples of Cell Culture Supernatants, Plasma, Serum and Tissue Homogenates. It is based upon a Sandwich assay principle and can be used to detect levels of TPSAB1 / Mast Cell Tryptase as low as 0.156 nanograms per millilter.

About TPSAB1 / Mast Cell Tryptase: Tryptases comprise a family of trypsin-like serine proteases, the peptidase family S1. Tryptases are enzymatically active only as heparin-stabilized tetramers, and they are resistant to all known endogenous proteinase inhibitors. Several tryptase genes are clustered on chromosome 16p13.3. These genes are characterized by several distinct features. They have a highly conserved 3' UTR and contain tandem repeat sequences at the 5' flank and 3' UTR which are thought to play a role in regulation of the mRNA stability. These genes have an intron immediately upstream of the initiator Met codon, which separates the site of transcription initiation from protein coding sequence. This feature is characteristic of tryptases but is unusual in other genes. (more)

Rat CD66a / CEACAM1 ELISA Kit (Sandwich ELISA) - LS-F17054

LS-F17054 is a 96-well enzyme-linked immunosorbent assay (ELISA) for the Quantitative detection of Rat CD66a / CEACAM1 in samples of Cell Culture Supernatants, Plasma, Serum and Tissue Homogenates. It is based upon a Sandwich assay principle and can be used to detect levels of CD66a / CEACAM1 as low as 0.312 nanograms per millilter.

About CD66a / CEACAM1: CD66a / CEACAM1 encodes a member of the carcinoembryonic antigen (CEA) gene family, which belongs to the immunoglobulin superfamily. Two subgroups of the CEA family, the CEA cell adhesion molecules and the pregnancy-specific glycoproteins, are located within a 1.2 Mb cluster on the long arm of chromosome 19. Eleven pseudogenes of the CEA cell adhesion molecule subgroup are also found in the cluster. The encoded protein was originally described in bile ducts of liver as biliary glycoprotein. Subsequently, it was found to be a cell-cell adhesion molecule detected on leukocytes, epithelia, and endothelia. The encoded protein mediates cell adhesion via homophilic as well as heterophilic binding to other proteins of the subgroup. (more)

Mouse Raptor / Mip1 ELISA Kit (Sandwich ELISA) - LS-F17982

LS-F17982 is a 96-well enzyme-linked immunosorbent assay (ELISA) for the detection of Mouse Raptor / Mip1 in samples of Cell Culture Supernatants, Plasma, Serum and Tissue Homogenates. It is based upon a Sandwich assay principle and can be used to detect levels of Raptor / Mip1 as low as 78 picograms per milliliter.

About Raptor / Mip1: Involved in the control of the mammalian target of rapamycin complex 1 (mTORC1) activity which regulates cell growth and survival, and autophagy in response to nutrient and hormonal signals; functions as a scaffold for recruiting mTORC1 substrates. mTORC1 is activated in response to growth factors or amino acids. Growth factor-stimulated mTORC1 activation involves a AKT1-mediated phosphorylation of TSC1-TSC2, which leads to the activation of the RHEB GTPase that potently activates the protein kinase activity of mTORC1. Amino acid-signaling to mTORC1 requires its relocalization to the lysosomes mediated by the Ragulator complex and the Rag GTPases. Activated mTORC1 up-regulates protein synthesis by phosphorylating key regulators of mRNA translation and ribosome synthesis. (more)

Rat CSPG4 / NG2 ELISA Kit (Sandwich ELISA) - LS-F19336

LS-F19336 is a 96-well enzyme-linked immunosorbent assay (ELISA) for the Quantitative detection of Rat CSPG4 / NG2 in samples of Cell Culture Supernatants, Plasma, Serum and Tissue Homogenates. It is based upon a Sandwich assay principle and can be used to detect levels of CSPG4 / NG2 as low as 0.312 nanograms per millilter.

About CSPG4 / NG2: Proteoglycan playing a role in cell proliferation and migration which stimulates endothelial cells motility during microvascular morphogenesis. May also inhibit neurite outgrowth and growth cone collapse during axon regeneration. Cell surface receptor for collagen alpha 2(VI) which may confer cells ability to migrate on that substrate. Binds through its extracellular N-terminus growth factors, extracellular matrix proteases modulating their activity. May regulate MPP16-dependent degradation and invasion of type I collagen participating in melanoma cells invasion properties. May modulate the plasminogen system by enhancing plasminogen activation and inhibiting angiostatin. (more)

Human PYCARD / ASC / TMS1 ELISA Kit (Sandwich ELISA) - LS-F19843

LS-F19843 is a 96-well enzyme-linked immunosorbent assay (ELISA) for the detection of Human PYCARD / ASC / TMS1 in samples of Cell Culture Supernatants, Plasma, Serum and Tissue Homogenates. It is based upon a Sandwich assay principle and can be used to detect levels of PYCARD / ASC / TMS1 as low as 0.156 nanograms per millilter.

About PYCARD / ASC / TMS1: Functions as key mediator in apoptosis and inflammation. Promotes caspase-mediated apoptosis involving predominantly caspase-8 and also caspase-9 in a probable cell type-specific manner. Involved in activation of the mitochondrial apoptotic pathway, promotes caspase-8-dependent proteolytic maturation of BID independently of FADD in certain cell types and also mediates mitochondrial translocation of BAX and activates BAX-dependent apoptosis coupled to activation of caspase-9, -2 and -3. Involved in macrophage pyroptosis, a caspase-1-dependent inflammatory form of cell death and is the major constituent of the ASC pyroptosome which forms upon potassium depletion and rapidly recruits and activates caspase-1. (more)

Rat MYBPC3 / MYBP-C ELISA Kit (Sandwich ELISA) - LS-F20622

LS-F20622 is a 96-well enzyme-linked immunosorbent assay (ELISA) for the Quantitative detection of Rat MYBPC3 / MYBP-C in samples of Cell Culture Supernatants, Plasma, Serum and Tissue Homogenates. It is based upon a Sandwich assay principle and can be used to detect levels of MYBPC3 / MYBP-C as low as 78 picograms per milliliter.

About MYBPC3 / MYBP-C: MYBPC3 encodes the cardiac isoform of myosin-binding protein C. Myosin-binding protein C is a myosin-associated protein found in the cross-bridge-bearing zone (C region) of A bands in striated muscle. MYBPC3, the cardiac isoform, is expressed exclussively in heart muscle. Regulatory phosphorylation of the cardiac isoform in vivo by cAMP-dependent protein kinase (PKA) upon adrenergic stimulation may be linked to modulation of cardiac contraction. Mutations in MYBPC3 are one cause of familial hypertrophic cardiomyopathy. (more)

Human BMP1 ELISA Kit (Sandwich ELISA) - LS-F20954

LS-F20954 is a 96-well enzyme-linked immunosorbent assay (ELISA) for the Quantitative detection of Human BMP1 in samples of Plasma and Serum. It is based upon a Sandwich assay principle and can be used to detect levels of BMP1 as low as 0.16 nanograms per millilter.

About BMP1: BMP1 encodes a Metallopeptidase M12A type protease that is comprised of an amino terminal signal peptide, prodomain and an astacin-like protease domain followed by CUB and EGF-like motifs. BMP1 protein has been shown to cleave chordin, the C-terminal propeptides of procollagen I, II, III and VII, pro-lysyl oxidase, probiglycan, and laminin-5, and its expression has been shown to induce cartilage and bone formation in vivo. At least six spliced variants have been reported. These share the N-terminal protease domain but differ in the C-terminus, and thus contain varying numbers of CUB and EGF-like domains. (more)

Rabbit CKMB / Creatine Kinase MB ELISA Kit (Sandwich ELISA) - LS-F21703

LS-F21703 is a 96-well enzyme-linked immunosorbent assay (ELISA) for the Quantitative detection of Rabbit CKMB / Creatine Kinase MB in samples of Plasma and Serum. It is based upon a Sandwich assay principle and can be used to detect levels of CKMB / Creatine Kinase MB as low as 0.16 nanograms per millilter.

About CKMB / Creatine Kinase MB: In the cells, the "cytosolic" CK enzymes consist of two subunits, which can be either B (brain type) or M (muscle type). There are, therefore, three different isoenzymes: CK-MM, CK-BB and CK-MB. The genes for these subunits are located on different chromosomes: B on 14q32 and M on 19q13. In addition to those three cytosolic CK isoforms, there are two mitochondrial creatine kinase isoenzymes, the ubiquitous and sarcomeric form. The functional entity of the latter two mitochondrial CK isoforms is an octamer consisting of four dimers each. Isoenzyme patterns differ in tissues. Skeletal muscle expresses CK-MM (98%) and low levels of CK-MB (1%). The myocardium (heart muscle), in contrast, expresses CK-MM at 70% and CK-MB at 25–30%. (more)

Human HLA-C ELISA Kit (Sandwich ELISA) - LS-F22179

LS-F22179 is a 96-well enzyme-linked immunosorbent assay (ELISA) for the Quantitative detection of Human HLA-C in samples of Plasma and Serum. It is based upon a Sandwich assay principle and can be used to detect levels of HLA-C as low as 0.31 nanograms per millilter.

About HLA-C: HLA-C belongs to the HLA class I heavy chain paralogues. This class I molecule is a heterodimer consisting of a heavy chain and a light chain (beta-2 microglobulin). The heavy chain is anchored in the membrane. Class I molecules play a central role in the immune system by presenting peptides derived from endoplasmic reticulum lumen. They are expressed in nearly all cells. The heavy chain is approximately 45 kDa and its gene contains 8 exons. Exon one encodes the leader peptide, exons 2 and 3 encode the alpha1 and alpha2 domain, which both bind the peptide, exon 4 encodes the alpha3 domain, exon 5 encodes the transmembrane region, and exons 6 and 7 encode the cytoplasmic tail. (more)

Pig Complement C3 ELISA Kit (Sandwich ELISA) - LS-F22708

LS-F22708 is a 96-well enzyme-linked immunosorbent assay (ELISA) for the Quantitative detection of Pig Complement C3 in samples of Plasma and Serum. It is based upon a Sandwich assay principle and can be used to detect levels of Complement C3 as low as 7.81 nanograms per millilter.

About Complement C3: C3 plays a central role in the activation of the complement system. Its processing by C3 convertase is the central reaction in both classical and alternative complement pathways. After activation C3b can bind covalently, via its reactive thioester, to cell surface carbohydrates or immune aggregates.Derived from proteolytic degradation of complement C3, C3a anaphylatoxin is a mediator of local inflammatory process. In chronic inflammation, acts as a chemoattractant for neutrophils (By similarity). It induces the contraction of smooth muscle, increases vascular permeability and causes histamine release from mast cells and basophilic leukocytes. (more)

Mouse PTH / Parathyroid Hormone ELISA Kit (Sandwich ELISA) - LS-F23085

LS-F23085 is a 96-well enzyme-linked immunosorbent assay (ELISA) for the Quantitative detection of Mouse PTH / Parathyroid Hormone in samples of Plasma and Serum. It is based upon a Sandwich assay principle and can be used to detect levels of PTH / Parathyroid Hormone as low as 15.63 picograms per milliliter.

About PTH / Parathyroid Hormone: PTH elevates calcium level by dissolving the salts in bone and preventing their renal excretion. Stimulates [1-14C]-2-deoxy-D-glucose (2DG) transport and glycogen synthesis in osteoblastic cells. (more)

Pig FASLG / Fas Ligand ELISA Kit (Sandwich ELISA) - LS-F23375

LS-F23375 is a 96-well enzyme-linked immunosorbent assay (ELISA) for the Quantitative detection of Pig FASLG / Fas Ligand in samples of Plasma and Serum. It is based upon a Sandwich assay principle and can be used to detect levels of FASLG / Fas Ligand as low as 23.44 picograms per milliliter.

About FASLG / Fas Ligand: Cytokine that binds to TNFRSF6/FAS, a receptor that transduces the apoptotic signal into cells. May be involved in cytotoxic T-cell mediated apoptosis and in T-cell development. TNFRSF6/FAS-mediated apoptosis may have a role in the induction of peripheral tolerance, in the antigen-stimulated suicide of mature T-cells, or both. Binding to the decoy receptor TNFRSF6B/DcR3 modulates its effects. (more)

Rat Metallothionein 1 ELISA Kit (Sandwich ELISA) - LS-F23589

LS-F23589 is a 96-well enzyme-linked immunosorbent assay (ELISA) for the Quantitative detection of Rat Metallothionein 1 in samples of Plasma and Serum. It is based upon a Sandwich assay principle and can be used to detect levels of Metallothionein 1 as low as 31.25 picograms per milliliter. (more)

Rat Complement C1q ELISA Kit (Sandwich ELISA) - LS-F25231

LS-F25231 is a 96-well enzyme-linked immunosorbent assay (ELISA) for the Quantitative detection of Rat Complement C1q in samples of Plasma and Serum. It is based upon a Sandwich assay principle and can be used to detect levels of Complement C1q as low as 0.781 nanograms per millilter.

About Complement C1q: C1q is a 400kDa protein formed from 18 peptide chains in 3 subunits (C1QA, C1QB, and C1QC). Each 6 peptide subunit consists of a Y-shaped pair of triple peptide helices joined at the stem and ending in a globular non-helical head. (more)

Human Copeptin ELISA Kit (Sandwich ELISA) - LS-F26731

LS-F26731 is a 96-well enzyme-linked immunosorbent assay (ELISA) for the Quantitative detection of Human Copeptin in samples of Cell Culture Supernatants, Plasma, Serum and Tissue Homogenates. It is based upon a Sandwich assay principle and can be used to detect levels of Copeptin as low as 250 picograms per milliliter. (more)

Human PAF / Platelet Activating Factor ELISA Kit (Sandwich ELISA) - LS-F27171

LS-F27171 is a 96-well enzyme-linked immunosorbent assay (ELISA) for the Quantitative detection of Human PAF / Platelet Activating Factor in samples of Cell Culture Supernatants, Plasma, Serum and Tissue Homogenates. It is based upon a Sandwich assay principle and can be used to detect levels of PAF / Platelet Activating Factor as low as 0.1 nanograms per millilter. (more)

Rat Acetylcholine ELISA Kit (Competitive EIA) - LS-F27870

LS-F27870 is a 96-well enzyme-linked immunosorbent assay (ELISA) for the Quantitative detection of Rat Acetylcholine in samples of Cell Culture Supernatants, Plasma, Serum and Tissue Homogenates. It is based upon a Competitive EIA assay principle and can be used to detect levels of Acetylcholine as low as 50 picograms per milliliter. (more)

Most Popular Proteins
Rhesus monkey CD40L Recombinant (His + S) Protein - LS-G11607

LS-G11607 is a Rhesus monkey CD40L recombinant protein generated in E. coli. This protein has been engineered to contain a His + S tag.

About CD40L: TNFSF5 is expressed on the surface of T cells. It regulates B cell function by engaging CD40 on the B cell surface. A defect in this gene results in inability of immunoglobulin class switch and is associated with hyper IgM syndrome. (more)

Sodium Dodecyl Sulfate - Polyacrylamide Gel Electrophoresis Image
Rat LGALS3 / Galectin 3 Recombinant (His) Protein - LS-G11991

LS-G11991 is a Rat LGALS3 / Galectin 3 recombinant protein generated in E. coli. This protein has been engineered to contain a His tag.

About LGALS3 / Galectin 3: LGALS3 / Galectin 3 is a member of the galectin family of carbohydrate binding proteins. Members of this protein family have an affinity for beta-galactosides. The encoded protein is characterized by an N-terminal proline-rich tandem repeat domain and a single C-terminal carbohydrate recognition domain. This protein can self-associate through the N-terminal domain allowing it to bind to multivalent saccharide ligands. This protein localizes to the extracellular matrix, the cytoplasm and the nucleus. This protein plays a role in numerous cellular functions including apoptosis, innate immunity, cell adhesion and T-cell regulation. The protein exhibits antimicrobial activity against bacteria and fungi. Alternate splicing results in multiple transcript variants. (more)

Sodium Dodecyl Sulfate - Polyacrylamide Gel Electrophoresis Image

Get Social With Us! Follow us on Facebook Follow us on Google+ Follow us on LinkedIn
Copyright © 2016 LifeSpan BioSciences, Inc. All Rights Reserved Privacy Policy
Catalog Number