LSBio The Immunohistochemistry Antibody Company
  • Home
  • Antibodies
    • Primary Antibodies
    • Secondary Antibodies
    • IHC-plus Antibodies
    • Isotype Control Antibodies
    • Blocking Peptides
  • ELISA Kits
    • All Kits
    • Sandwich ELISA Kits
    • EIA Kits
    • Cell-Based ELISA Kits
    • DNA-Binding ELISA Kits
    • Direct ELISA Kits
    • Functional ELISA Kits
  • Services
    • Immunohistochemistry Studies
    • Tissue Cross-Reactivity Screening
  • Distributors
  • Resources
    • About our Tissue Bank
    • Customer Support
    • How to Buy
    • IHC-plus Protocol
    • LSBio Media
    • Publications
    • Secure FTP Login
    • IHC Database Login
  • Company
    • About LifeSpan
    • Press Releases
    • Holiday Schedule
    • Contact Us
  • View Cart

Unfortunately, the antibody LS-C178343 is no longer available.

Below is a list of antibodies to the same protein target. You may also try your search again using the search box at the top of the page. Please contact us if you have any questions.



ACE / CD143 Antibodies

angiotensin I converting enzyme

Gene Name: angiotensin I converting enzyme
Family/Subfamily: Protease , Metallopeptidase M2
Synonyms: ACE Antibody, ACE1 Antibody, Angiotensin-converting enzyme Antibody, CD143 Antibody, CD143 antigen Antibody, Carboxycathepsin Antibody, DIPEPTIDYL CARBOXYPEPTIDASE Antibody, DCP Antibody, Dipeptidyl carboxypeptidase I Antibody, ICH Antibody, Kininase II Antibody, MVCD3 Antibody, Peptidyl-dipeptidase A Antibody, Peptidase P Antibody, DCP1 Antibody, Dipeptidyl carboxypeptidase 1 Antibody, Testicular ECA Antibody
Target Sequences: NM_000789 NP_000780.1 P12821
 ACE / CD143 Feature Table
Featured Image

Featured ACE / CD143 Antibody

LS-B10663 is a mouse monoclonal antibody that LifeSpan has tested extensively in immunohistochemistry (IHC) and is an excellent antibody for use in formalin-fixed paraffin embedded tissues. Multiple tissues were immunolabeled and the results were interpreted by a LifeSpan pathologist. This image shows an example of staining in formalin-fixed paraffin embedded tissue. Learn more about our IHC Validation procedure. All LSBio antibodies are 100% guaranteed.


Loading ...

Target Reactivity Applications Host Isotype Clonality Clone Format Epitope Publications Type
ACE / CD143 Mouse IgG2a Monoclonal Unconjugated Human, Mouse IHC-P, WB No Primary
Anti-ACE / CD143 Antibody IHC-plus™ LS-B10663
IHC Image
WB Image
Mouse Monoclonal (IgG2a) to Human ACE / CD143
Human, Mouse
IHC - Paraffin, Western blot
Unconjugated
ACE / CD143 Mouse IgG1 Monoclonal Unconjugated Human, Monkey, Mouse, Rat, Bovine, Cat, Dog, Guinea pig, Rabbit IHC-P, WB No Primary
Anti-ACE / CD143 Antibody IHC-plus™ LS-B2558
IHC Image
Mouse Monoclonal (IgG1) to Human ACE / CD143
Human, Monkey, Mouse, Rat, Bovine, Cat, Dog, Guinea pig, Rabbit
IHC - Paraffin, Western blot
Unconjugated
ACE / CD143 Rabbit IgG Monoclonal EPR2757 Unconjugated Human, Mouse IHC-P, WB, Flo C-Terminus No Primary
Anti-ACE / CD143 Antibody (C-Terminus, clone EPR2757) LS-C105463
IHC Image
IHC Image
Rabbit Monoclonal [clone EPR2757] (IgG) to Human ACE / CD143
Human, Mouse
IHC - Paraffin, Western blot, Flow Cytometry
Unconjugated
ACE / CD143 Mouse IgG1 Monoclonal Unconjugated Human, Monkey, Rat, Cat, Hamster IHC-Fr, ICC, WB, IP, ELISA No Primary
Anti-ACE / CD143 Antibody LS-C152940
IHC Image
Mouse Monoclonal (IgG1) to Human ACE / CD143
Human, Monkey, Rat, Cat, Hamster
IHC - Frozen, ICC, Western blot, Immunoprecipitation, ELISA
Unconjugated
ACE / CD143 Goat IgG Polyclonal Unconjugated Mouse IHC, WB, IP, Flo aa35-1264 No Primary
Anti-ACE / CD143 Antibody (aa35-1264) LS-C150144
IHC Image
Goat Polyclonal (IgG) to Mouse ACE / CD143
Mouse
IHC, Western blot, Immunoprecipitation, Flow Cytometry
Unconjugated
ACE / CD143 Mouse IgG1 Monoclonal Unconjugated Human, Monkey, Rat, Cat, Hamster IHC-P, IHC-Fr, ICC, WB, IP, ELISA N-Terminus No Primary
Anti-ACE / CD143 Antibody (N-Terminus) LS-C3698
Mouse Monoclonal (IgG1) to Human ACE / CD143
Human, Monkey, Rat, Cat, Hamster
IHC - Paraffin, IHC - Frozen, ICC, Western blot, Immunoprecipitation, ELISA
Unconjugated
ACE / CD143 Goat IgG Polyclonal Unconjugated Human IHC, WB, Flo, ELISA No Primary
Anti-ACE / CD143 Antibody LS-C149875
Goat Polyclonal (IgG) to Human ACE / CD143
Human
IHC, Western blot, Flow Cytometry, ELISA
Unconjugated
ACE / CD143 Rabbit IgG Polyclonal Unconjugated Human, Mouse, Rat IHC, WB, ELISA aa891-940 No Primary
Anti-ACE / CD143 Antibody (aa891-940) LS-C291661
Rabbit Polyclonal (IgG) to Human ACE / CD143
Human, Mouse, Rat
IHC, Western blot, ELISA
Unconjugated
ACE / CD143 Mouse IgG1 Monoclonal 3C5 Unconjugated Human IHC-P, WB, ELISA No Primary
Anti-ACE / CD143 Antibody (clone 3C5) LS-C202595
Mouse Monoclonal [clone 3C5] (IgG1) to Human ACE / CD143
Human
IHC - Paraffin, Western blot, ELISA
Unconjugated
ACE / CD143 Mouse IgM Monoclonal Unconjugated Human, Mouse, Bovine IHC, Flo, ELISA No Primary
Anti-ACE / CD143 Antibody LS-C83323
Mouse Monoclonal (IgM) to Human ACE / CD143
Human, Mouse, Bovine
IHC, Flow Cytometry, ELISA
Unconjugated
ACE / CD143 Rabbit Polyclonal Unconjugated Human, Mouse, Rat IHC, WB Phe940 No Primary
Anti-ACE / CD143 Antibody (Phe940) LS-C177548
Rabbit Polyclonal to Human ACE / CD143
Human, Mouse, Rat
IHC, Western blot
Unconjugated
ACE / CD143 Mouse IgM Monoclonal Unconjugated Human, Bovine IHC, ELISA No Primary
Anti-ACE / CD143 Antibody LS-C84234
Mouse Monoclonal (IgM) to Human ACE / CD143
Human, Bovine
IHC, ELISA
Unconjugated
ACE / CD143 Mouse Monoclonal CG2 Unconjugated Human IHC-P No Primary
Anti-ACE / CD143 Antibody (clone CG2) LS-C96272
Mouse Monoclonal [clone CG2]
Human
IHC - Paraffin
Unconjugated
ACE / CD143 Mouse IgG1 Monoclonal 2E2 Unconjugated Human IHC No Primary
Anti-ACE / CD143 Antibody (clone 2E2) LS-C84940
Mouse Monoclonal [clone 2E2] (IgG1) to Human ACE / CD143
Human
IHC
Unconjugated
ACE / CD143 Goat IgG Polyclonal Unconjugated Human IHC, WB, Flo, ELISA, Neut aa30-1261 No Primary
Anti-ACE / CD143 Antibody (aa30-1261) LS-C122666
Goat Polyclonal (IgG) to Human ACE / CD143
Human
IHC, Western blot, Flow Cytometry, ELISA, Neutralization
Unconjugated
ACE / CD143 Mouse IgG1 Monoclonal Unconjugated Human IHC-Fr, ICC, IP, ELISA N-Terminus No Primary
Anti-ACE / CD143 Antibody (N-Terminus) LS-C3727
Mouse Monoclonal (IgG1) to Human ACE / CD143
Human
IHC - Frozen, ICC, Immunoprecipitation, ELISA
Unconjugated
ACE / CD143 Mouse IgG1 Monoclonal Unconjugated Human, Monkey, Rat, Cat, Hamster IHC-Fr, IP, Flo, ELISA N-Terminus No Primary
Anti-ACE / CD143 Antibody (N-Terminus) LS-C3715
Mouse Monoclonal (IgG1) to Human ACE / CD143
Human, Monkey, Rat, Cat, Hamster
IHC - Frozen, Immunoprecipitation, Flow Cytometry, ELISA
Unconjugated
ACE / CD143 Mouse IgG1 Monoclonal Unconjugated Human, Monkey IHC-Fr, IP, Flo, ELISA N-Terminus No Primary
Anti-ACE / CD143 Antibody (N-Terminus) LS-C3714
Mouse Monoclonal (IgG1) to Human ACE / CD143
Human, Monkey
IHC - Frozen, Immunoprecipitation, Flow Cytometry, ELISA
Unconjugated
ACE / CD143 Mouse IgG1 Monoclonal Unconjugated Human, Monkey, Rat, Bovine, Cat, Dog, Guinea pig, Rabbit IHC-P, WB, ELISA No Primary
Anti-ACE / CD143 Antibody LS-C3706
Mouse Monoclonal (IgG1) to Human ACE / CD143
Human, Monkey, Rat, Bovine, Cat, Dog, Guinea pig, Rabbit
IHC - Paraffin, Western blot, ELISA
Unconjugated
ACE / CD143 Mouse IgM Monoclonal Unconjugated Human, Mouse, Rat, Bovine IHC, Flo, ELISA No Primary
Anti-ACE / CD143 Antibody LS-C3695
Mouse Monoclonal (IgM) to Human ACE / CD143
Human, Mouse, Rat, Bovine
IHC, Flow Cytometry, ELISA
Unconjugated
ACE / CD143 Mouse IgG1 Monoclonal Unconjugated Human, Monkey, Mouse, Rat, Bovine, Cat, Dog, Guinea pig, Rabbit IHC-P, WB, ELISA No Primary
Anti-ACE / CD143 Antibody LS-C3716
Mouse Monoclonal (IgG1) to Human ACE / CD143
Human, Monkey, Mouse, Rat, Bovine, Cat, Dog, Guinea pig, Rabbit
IHC - Paraffin, Western blot, ELISA
Unconjugated
ACE / CD143 Goat IgG Polyclonal Biotin Conjugated Human IHC, WB No Primary
Anti-ACE / CD143 Antibody (Biotin) LS-C122667
Goat Polyclonal (IgG) to Human ACE / CD143
Human
IHC, Western blot
Biotin Conjugated
ACE / CD143 Mouse IgG1 Monoclonal I2H5 PE Conjugated Human IHC-Fr No Primary
Anti-ACE / CD143 Antibody (clone I2H5, PE) LS-C122665
Mouse Monoclonal [clone I2H5] (IgG1) to Human ACE / CD143
Human
IHC - Frozen
PE Conjugated
ACE / CD143 Mouse IgG1,k Monoclonal 6A4 Unconjugated Human WB, ELISA No Primary
Anti-ACE / CD143 Antibody (clone 6A4) LS-C197027
ELISA Image
Mouse Monoclonal [clone 6A4] (IgG1,k) to Human ACE / CD143
Human
Western blot, ELISA
Unconjugated
ACE / CD143 Rabbit IgG Polyclonal Unconjugated Human WB, ELISA aa1160-1306 No Primary
Anti-ACE / CD143 Antibody (aa1160-1306) LS-C314333
WB Image
Rabbit Polyclonal (IgG) to Human ACE / CD143
Human
Western blot, ELISA
Unconjugated
ACE / CD143 Rabbit IgG Polyclonal Unconjugated Pig WB, ELISA aa918-1088 No Primary
Anti-ACE / CD143 Antibody (aa918-1088) LS-C292838
WB Image
Rabbit Polyclonal (IgG) to Pig ACE / CD143
Pig
Western blot, ELISA
Unconjugated
ACE / CD143 Rabbit IgG Polyclonal Unconjugated Human WB, ELISA aa814-1071 No Primary
Anti-ACE / CD143 Antibody (aa814-1071) LS-C292835
WB Image
Rabbit Polyclonal (IgG) to Human ACE / CD143
Human
Western blot, ELISA
Unconjugated
ACE / CD143 Rabbit IgG Polyclonal Unconjugated Mouse WB, ELISA aa504-597 No Primary
Anti-ACE / CD143 Antibody (aa504-597) LS-C292837
WB Image
Rabbit Polyclonal (IgG) to Mouse ACE / CD143
Mouse
Western blot, ELISA
Unconjugated
ACE / CD143 Rabbit Polyclonal Unconjugated Human, Mouse WB C-Terminus No Primary
Anti-ACE / CD143 Antibody (C-Terminus) LS-C96731
WB Image
Rabbit Polyclonal to Human ACE / CD143
Human, Mouse
Western blot
Unconjugated
ACE / CD143 Rabbit IgG Polyclonal FITC Conjugated Human WB, ELISA aa814-1071 No Primary
Anti-ACE / CD143 Antibody (aa814-1071, FITC) LS-C301612
Rabbit Polyclonal (IgG) to Human ACE / CD143
Human
Western blot, ELISA
FITC Conjugated
ACE / CD143 Rabbit IgG Polyclonal FITC Conjugated Pig WB, ELISA aa918-1088 No Primary
Anti-ACE / CD143 Antibody (aa918-1088, FITC) LS-C301614
Rabbit Polyclonal (IgG) to Pig ACE / CD143
Pig
Western blot, ELISA
FITC Conjugated
ACE / CD143 Rabbit IgG Polyclonal Biotin Conjugated Pig WB, ELISA aa918-1088 No Primary
Anti-ACE / CD143 Antibody (aa918-1088, Biotin) LS-C299367
Rabbit Polyclonal (IgG) to Pig ACE / CD143
Pig
Western blot, ELISA
Biotin Conjugated
ACE / CD143 Rabbit IgG Polyclonal Biotin Conjugated Human WB, ELISA aa814-1071 No Primary
Anti-ACE / CD143 Antibody (aa814-1071, Biotin) LS-C299362
Rabbit Polyclonal (IgG) to Human ACE / CD143
Human
Western blot, ELISA
Biotin Conjugated
ACE / CD143 Rabbit IgG Polyclonal Biotin Conjugated Mouse WB, ELISA aa504-597 No Primary
Anti-ACE / CD143 Antibody (aa504-597, Biotin) LS-C299366
Rabbit Polyclonal (IgG) to Mouse ACE / CD143
Mouse
Western blot, ELISA
Biotin Conjugated
ACE / CD143 Mouse IgG1 Monoclonal i2H5 Biotin Conjugated Human Flo No Primary
Anti-ACE / CD143 Antibody (clone i2H5, Biotin) LS-C202337
Mouse Monoclonal [clone i2H5] (IgG1) to Human ACE / CD143
Human
Flow Cytometry
Biotin Conjugated
ACE / CD143 Mouse IgG1 Monoclonal i2H5 FITC Conjugated Human Flo No Primary
Anti-ACE / CD143 Antibody (clone i2H5, FITC) LS-C202338
Mouse Monoclonal [clone i2H5] (IgG1) to Human ACE / CD143
Human
Flow Cytometry
FITC Conjugated
ACE / CD143 Mouse IgG1 Monoclonal i2H5 RPE Conjugated Human Flo No Primary
Anti-ACE / CD143 Antibody (clone i2H5, RPE) LS-C202339
Mouse Monoclonal [clone i2H5] (IgG1) to Human ACE / CD143
Human
Flow Cytometry
RPE Conjugated
ACE / CD143 Rabbit IgG Polyclonal Unconjugated Human WB aa401-761 No Primary
Anti-ACE / CD143 Antibody (aa401-761) LS-C311484
Rabbit Polyclonal (IgG) to Human ACE / CD143
Human
Western blot
Unconjugated
ACE / CD143 Mouse Monoclonal Unconjugated Human, Mouse WB N-Terminus No Primary
Anti-ACE / CD143 Antibody (N-Terminus) LS-C342271
Mouse Monoclonal to Human ACE / CD143
Human, Mouse
Western blot
Unconjugated
ACE / CD143 Rabbit IgG Polyclonal FITC Conjugated Mouse WB aa504-597 No Primary
Anti-ACE / CD143 Antibody (aa504-597, FITC) LS-C301613
Rabbit Polyclonal (IgG) to Mouse ACE / CD143
Mouse
Western blot
FITC Conjugated
ACE / CD143 Mouse IgG1 Monoclonal Unconjugated Human WB, ELISA aa30-1261 No Primary
Anti-ACE / CD143 Antibody (aa30-1261) LS-C125077
Mouse Monoclonal (IgG1) to Human ACE / CD143
Human
Western blot, ELISA
Unconjugated
ACE / CD143 Rabbit IgG Polyclonal Unconjugated Mouse, Human, Rat WB, ELISA No Primary
Anti-ACE / CD143 Antibody LS-C3702
Rabbit Polyclonal (IgG) to Mouse ACE / CD143
Mouse, Human, Rat
Western blot, ELISA
Unconjugated
ACE / CD143 Mouse IgG1 Monoclonal PE Conjugated Human, Monkey Flo No Primary
Anti-ACE / CD143 Antibody (PE) LS-C3722
Mouse Monoclonal (IgG1) to Human ACE / CD143
Human, Monkey
Flow Cytometry
PE Conjugated
ACE / CD143 Mouse IgG1 Monoclonal FITC Conjugated Human, Monkey Flo N-Terminus No Primary
Anti-ACE / CD143 Antibody (N-Terminus, FITC) LS-C3721
Mouse Monoclonal (IgG1) to Human ACE / CD143
Human, Monkey
Flow Cytometry
FITC Conjugated
ACE / CD143 Mouse IgG1 Monoclonal FITC Conjugated Human, Monkey, Rat, Cat, Hamster Flo N-Terminus No Primary
Anti-ACE / CD143 Antibody (N-Terminus, FITC) LS-C3720
Mouse Monoclonal (IgG1) to Human ACE / CD143
Human, Monkey, Rat, Cat, Hamster
Flow Cytometry
FITC Conjugated
ACE / CD143 Mouse IgG1 Monoclonal FITC Conjugated Human Flo No Primary
Anti-ACE / CD143 Antibody (FITC) LS-C69016
Mouse Monoclonal (IgG1) to Human ACE / CD143
Human
Flow Cytometry
FITC Conjugated
ACE / CD143 Mouse IgG1 Monoclonal PE Conjugated Human, Monkey, Rat, Cat, Hamster Flo N-Terminus No Primary
Anti-ACE / CD143 Antibody (N-Terminus, PE) LS-C3724
Mouse Monoclonal (IgG1) to Human ACE / CD143
Human, Monkey, Rat, Cat, Hamster
Flow Cytometry
PE Conjugated
ACE / CD143 Mouse IgG1 Monoclonal PE Conjugated Human, Monkey Flo N-Terminus No Primary
Anti-ACE / CD143 Antibody (N-Terminus, PE) LS-C3723
Mouse Monoclonal (IgG1) to Human ACE / CD143
Human, Monkey
Flow Cytometry
PE Conjugated
ACE / CD143 Mouse IgG1 Monoclonal FITC Conjugated Human, Monkey, Rat Flo No Primary
Anti-ACE / CD143 Antibody (FITC) LS-C3719
Mouse Monoclonal (IgG1) to Human ACE / CD143
Human, Monkey, Rat
Flow Cytometry
FITC Conjugated
ACE / CD143 Mouse IgG1 Monoclonal I2H5 FITC Conjugated Human Flo No Primary
Anti-ACE / CD143 Antibody (clone I2H5, FITC) LS-C126786
Mouse Monoclonal [clone I2H5] (IgG1) to Human ACE / CD143
Human
Flow Cytometry
FITC Conjugated
ACE / CD143 Mouse IgG1 Monoclonal I2H5 Biotin Conjugated Human Flo No Primary
Anti-ACE / CD143 Antibody (clone I2H5, Biotin) LS-C126785
Mouse Monoclonal [clone I2H5] (IgG1) to Human ACE / CD143
Human
Flow Cytometry
Biotin Conjugated
ACE / CD143 Mouse IgG1 Monoclonal PE Conjugated Human Flo No Primary
Anti-ACE / CD143 Antibody (PE) LS-C125078
Mouse Monoclonal (IgG1) to Human ACE / CD143
Human
Flow Cytometry
PE Conjugated
ACE / CD143 Mouse IgG1 Monoclonal Biotin Conjugated Human, Monkey, Rat, Cat, Hamster Flo N-Terminus No Primary
Anti-ACE / CD143 Antibody (N-Terminus, Biotin) LS-C3718
Mouse Monoclonal (IgG1) to Human ACE / CD143
Human, Monkey, Rat, Cat, Hamster
Flow Cytometry
Biotin Conjugated
ACE / CD143 Mouse IgG1 Monoclonal Biotin Conjugated Human, Monkey Flo N-Terminus No Primary
Anti-ACE / CD143 Antibody (N-Terminus, Biotin) LS-C3717
Mouse Monoclonal (IgG1) to Human ACE / CD143
Human, Monkey
Flow Cytometry
Biotin Conjugated
ACE / CD143 Mouse IgG1 Monoclonal Biotin Conjugated Human Flo No Primary
Anti-ACE / CD143 Antibody (Biotin) LS-C125076
Mouse Monoclonal (IgG1) to Human ACE / CD143
Human
Flow Cytometry
Biotin Conjugated
Target Corresponding Antibodies
ACE / CD143
ACE / DCP1 / CD143 Antibody Blocking Peptide - LS-E9264
LS-E9264
ACE / CD143
LS-C96731
Type Target Reactivity Sample Type
Sandwich ACE / CD143 Mouse Cell Culture Supernatants, Plasma, Serum
Mouse ACE / CD143 ELISA Kit - LS-F217
Sandwich
Mouse
96-Well Microplate with Colorimetric - 450nm detection type
Cell Culture Supernatants, Plasma, Serum
Sandwich ACE / CD143 Human Cell Lysates, Plasma, Sera
Human ACE / CD143 ELISA Kit - LS-F672
Sandwich
Human
12 x 8-Well Microstrips with Colorimetric - 450nm detection type
Cell Lysates, Plasma, Sera
Sandwich ACE / CD143 Human Cell Culture Supernatants, Heparin Plasma, Saliva, Serum
Human ACE / CD143 ELISA Kit - LS-F2574
Sandwich
Human
96-Well Microplate with unknown detection type
Cell Culture Supernatants, Heparin Plasma, Saliva, Serum
Sandwich ACE / CD143 Mouse Cell Culture Supernatants, Heparin Plasma, Serum
Mouse ACE / CD143 ELISA Kit - LS-F2575
Sandwich
Mouse
96-Well Microplate with unknown detection type
Cell Culture Supernatants, Heparin Plasma, Serum
Sandwich ACE / CD143 Human Cell Culture Supernatants, Cell Lysates, Plasma, Serum, Tissue Homogenates
Human ACE / CD143 ELISA Kit - LS-F3949
Sandwich
Human
96-Well Strip Plate with Colorimetric - 450nm detection type
Cell Culture Supernatants, Cell Lysates, Plasma, Serum, Tissue Homogenates
Sandwich ACE / CD143 Rat Cerebrospinal Fluid, Plasma, Serum
Rat ACE / CD143 ELISA Kit - LS-F3950
Sandwich
Rat
96-Well Strip Plate with Colorimetric - 450nm detection type
Cerebrospinal Fluid, Plasma, Serum
Sandwich ACE / CD143 Mouse Cell Culture Supernatants, Plasma, Serum, Tissue Homogenates
Mouse ACE / CD143 ELISA Kit - LS-F3951
Sandwich
Mouse
96-Well Strip Plate with Colorimetric - 450nm detection type
Cell Culture Supernatants, Plasma, Serum, Tissue Homogenates
Sandwich ACE / CD143 Pig Plasma, Serum
Pig ACE / CD143 ELISA Kit - LS-F5827
Sandwich
Pig
96-Well Strip Plate with Colorimetric - 450nm detection type
Plasma, Serum
Sandwich ACE / CD143 Rabbit Plasma, Serum
Rabbit ACE / CD143 ELISA Kit - LS-F5965
Sandwich
Rabbit
96-Well Strip Plate with Colorimetric - 450nm detection type
Plasma, Serum
Sandwich ACE / CD143 Cow Plasma, Serum
Cow ACE / CD143 ELISA Kit - LS-F5966
Sandwich
Cow
96-Well Strip Plate with Colorimetric - 450nm detection type
Plasma, Serum

ACE / CD143 Feature Table


Feature Type Location Details
alternative products 1 - 1306 Event=Alternative splicing; Named isoforms=3; Name=Somatic-1; IsoId=P12821-1; Sequence=Displayed; Name=Somatic-2; Synonyms=Soluble; IsoId=P12821-2; Sequence=VSP_029932, VSP_029933; Note=Incomplete sequence; Name=Testis-specific; Synonyms=ACE-T; IsoId=P12821-3, P22966-1; Sequence=VSP_035120, VSP_035121; Note=Variant in position: 32:S->P (in dbSNP:rs4317). Variant in position: 49:S->G (in dbSNP:rs4318);
biophysicochemical properties 1 - 1306 Kinetic parameters: KM=2.51 mM for Hip-His-Leu;
catalytic activity 1 - 1306 Release of a C-terminal dipeptide, oligopeptide-|-Xaa-Yaa, when Xaa is not Pro, and Yaa is neither Asp nor Glu. Thus, conversion of angiotensin I to angiotensin II, with increase in vasoconstrictor activity, but no action on angiotensin II.
cofactor 1 - 1306 Binds 2 zinc ions per subunit. Isoform Testis-specific only binds 1 zinc ion per subunit.
cofactor 1 - 1306 Binds 3 chloride ions per subunit.
Disease 1 - 1306 Defects in ACE are a cause of renal tubular dysgenesis (RTD) [MIM:267430]. RTD is an autosomal recessive severe disorder of renal tubular development characterized by persistent fetal anuria and perinatal death, probably due to pulmonary hypoplasia from early-onset oligohydramnios (the Potter phenotype).
Disease 1 - 1306 Genetic variations in ACE could influence susceptibility to diabetic nephropathy [MIM:612624]; also called susceptibility to microvascular complications of diabetes type 3 (MVCD3) or susceptibility to diabetic end-stage renal disease (ESRD). Diabetic nephropathy is a kidney disease and resultant kidney function impairment due to the long standing effects of diabetes on the microvasculature (glomerulus) of the kidney. Features include increased urine protein and declining kidney function.
Disease 1 - 1306 Genetic variations in ACE may be a cause of susceptibility to ischemic stroke [MIM:601367]; also known as cerebrovascular accident or cerebral infarction. A stroke is an acute neurologic event leading to death of neural tissue of the brain and resulting in loss of motor, sensory and/or cognitive function. Ischemic strokes, resulting from vascular occlusion, is considered to be a highly complex disease consisting of a group of heterogeneous disorders with multiple genetic and environmental risk factors.
enzyme regulation 1 - 1306 Strongly activated by chloride. Specifically inhibited by lisinopril, captopril and enalaprilat.
Function 1 - 1306 Converts angiotensin I to angiotensin II by release of the terminal His-Leu, this results in an increase of the vasoconstrictor activity of angiotensin. Also able to inactivate bradykinin, a potent vasodilator. Has also a glycosidase activity which releases GPI-anchored proteins from the membrane by cleaving the mannose linkage in the GPI moiety.
Induction 1 - 1306 Up-regulated in failing heart.
miscellaneous 1 - 1306 Inhibitors of ACE are commonly used to treat hypertension and some types of renal and cardiac dysfunction.
miscellaneous 1 - 1306 The glycosidase activity probably uses different active site residues than the metalloprotease activity.
ptm 1 - 1306 Phosphorylated by CK2 on Ser-1299; which allows membrane retention.
sequence caution 1 - 1306 Sequence=BAD92208.1; Type=Erroneous initiation;
Similarity 1 - 1306 Belongs to the peptidase M2 family.
Subcellular Location 1 - 1306 Angiotensin-converting enzyme, soluble form: Secreted.
Subcellular Location 1 - 1306 Cell membrane; Single-pass type I membrane protein.
Tissue Specificity 1 - 1306 Ubiquitously expressed, with highest levels in lung, kidney, heart, gastrointestinal system and prostate. Isoform Testis-specific is expressed in spermatocytes and adult testis.
web resource 1 - 1306 Name=GeneReviews; URL="http://www.ncbi.nlm.nih.gov/sites/GeneTests/lab/gene/ACE";
web resource 1 - 1306 Name=SHMPD; Note=The Singapore human mutation and polymorphism database; URL="http://shmpd.bii.a-star.edu.sg/gene.php?genestart=A&genename=ACE";
arrayexpress 1 - 1306 P12821
bgee 1 - 1306 P12821
brenda 1 - 1306 3.4.15.1
cleanex 1 - 1306 HS_ACE
ctd 1 - 1306 1636
doi 1 - 1306 10
drugbank 1 - 1306 DB00178
drugbank 1 - 1306 DB00492
drugbank 1 - 1306 DB00519
drugbank 1 - 1306 DB00542
drugbank 1 - 1306 DB00584
drugbank 1 - 1306 DB00691
drugbank 1 - 1306 DB00722
drugbank 1 - 1306 DB00790
drugbank 1 - 1306 DB00881
drugbank 1 - 1306 DB01089
drugbank 1 - 1306 DB01180
drugbank 1 - 1306 DB01197
drugbank 1 - 1306 DB01348
eggnog 1 - 1306 prNOG16721
embl 1 - 1306 AB208971
embl 1 - 1306 AF118569
embl 1 - 1306 AY436326
embl 1 - 1306 EU332840
embl 1 - 1306 J04144
embl 1 - 1306 M26657
embl 1 - 1306 X16295
ensembl 1 - 1306 ENST00000290866
genecards 1 - 1306 GC17P061554
geneid 1 - 1306 1636
genevestigator 1 - 1306 P12821
germonline 1 - 1306 ENSG00000159640
go 1 - 1306 GO:0001822
go 1 - 1306 GO:0001974
go 1 - 1306 GO:0002005
go 1 - 1306 GO:0002019
go 1 - 1306 GO:0003779
go 1 - 1306 GO:0004180
go 1 - 1306 GO:0005615
go 1 - 1306 GO:0005624
go 1 - 1306 GO:0005768
go 1 - 1306 GO:0005886
go 1 - 1306 GO:0008144
go 1 - 1306 GO:0008237
go 1 - 1306 GO:0008241
go 1 - 1306 GO:0008270
go 1 - 1306 GO:0009897
go 1 - 1306 GO:0014910
go 1 - 1306 GO:0016021
go 1 - 1306 GO:0019229
go 1 - 1306 GO:0031404
go 1 - 1306 GO:0031711
go 1 - 1306 GO:0032943
go 1 - 1306 GO:0042312
go 1 - 1306 GO:0042447
go 1 - 1306 GO:0043171
go 1 - 1306 GO:0050482
go 1 - 1306 GO:0060218
h-invdb 1 - 1306 HIX0027185
hgnc 1 - 1306 HGNC:2707
hogenom 1 - 1306 HBG356536
hovergen 1 - 1306 HBG000264
hpa 1 - 1306 CAB002426
hpa 1 - 1306 CAB002921
inparanoid 1 - 1306 P12821
interpro 1 - 1306 IPR001548
ipi 1 - 1306 IPI00028147
ipi 1 - 1306 IPI00437751
ipi 1 - 1306 IPI00877100
kegg 1 - 1306 hsa:1636
medline 1 - 1306 20429895
medline 1 - 1306 20517872
medline 1 - 1306 22347248
medline 1 - 1306 89071703
medline 1 - 1306 89338720
medline 1 - 1306 90046671
medline 1 - 1306 90110025
medline 1 - 1306 91308093
medline 1 - 1306 96302256
medline 1 - 1306 98308142
medline 1 - 1306 99251580
medline 1 - 1306 99318094
merops 1 - 1306 M02.001
merops 1 - 1306 M02.004
mim 1 - 1306 106180
mim 1 - 1306 267430
mim 1 - 1306 601367
mim 1 - 1306 612624
nextbio 1 - 1306 6722
oma 1 - 1306 EFWDKSM
orphanet 1 - 1306 3033
orthodb 1 - 1306 EOG9QVFXH
panther 1 - 1306 PTHR10514
pdb 1 - 1306 1O86
pdb 1 - 1306 1O8A
pdb 1 - 1306 1UZE
pdb 1 - 1306 1UZF
pdb 1 - 1306 2C6F
pdb 1 - 1306 2C6N
pdb 1 - 1306 2IUL
pdb 1 - 1306 2IUX
pdb 1 - 1306 2OC2
pdb 1 - 1306 3BKK
pdb 1 - 1306 3BKL
pdb 1 - 1306 3L3N
pdbsum 1 - 1306 1O86
pdbsum 1 - 1306 1O8A
pdbsum 1 - 1306 1UZE
pdbsum 1 - 1306 1UZF
pdbsum 1 - 1306 2C6F
pdbsum 1 - 1306 2C6N
pdbsum 1 - 1306 2IUL
pdbsum 1 - 1306 2IUX
pdbsum 1 - 1306 2OC2
pdbsum 1 - 1306 3BKK
pdbsum 1 - 1306 3BKL
pdbsum 1 - 1306 3L3N
peptideatlas 1 - 1306 P12821
pfam 1 - 1306 PF01401
pharmgkb 1 - 1306 PA139
phosphosite 1 - 1306 P12821
phylomedb 1 - 1306 P12821
pir 1 - 1306 A31759
pir 1 - 1306 PW0053
pir 1 - 1306 S05238
pmap-cutdb 1 - 1306 P12821
pride 1 - 1306 P12821
prints 1 - 1306 PR00791
prosite 1 - 1306 PS00142
proteinmodelportal 1 - 1306 P12821
pubmed 1 - 1306 10099885
pubmed 1 - 1306 10319862
pubmed 1 - 1306 10391210
pubmed 1 - 1306 10769174
pubmed 1 - 1306 10924499
pubmed 1 - 1306 10969042
pubmed 1 - 1306 11076943
pubmed 1 - 1306 11551873
pubmed 1 - 1306 12386153
pubmed 1 - 1306 12459472
pubmed 1 - 1306 12540854
pubmed 1 - 1306 12542396
pubmed 1 - 1306 14694062
pubmed 1 - 1306 15151696
pubmed 1 - 1306 15236580
pubmed 1 - 1306 15277638
pubmed 1 - 1306 15534175
pubmed 1 - 1306 15671045
pubmed 1 - 1306 16116425
pubmed 1 - 1306 16335952
pubmed 1 - 1306 16476442
pubmed 1 - 1306 1649623
pubmed 1 - 1306 17924679
pubmed 1 - 1306 19159218
pubmed 1 - 1306 2547653
pubmed 1 - 1306 2554286
pubmed 1 - 1306 2558109
pubmed 1 - 1306 2849100
pubmed 1 - 1306 8755737
pubmed 1 - 1306 9013598
pubmed 1 - 1306 9642152
refseq 1 - 1306 NP_000780.1
refseq 1 - 1306 NP_001171528.1
refseq 1 - 1306 NP_690043.1
string 1 - 1306 P12821
ucsc 1 - 1306 uc002jau.1
unigene 1 - 1306 Hs.654434
alt_init; mrna 1 - 1306 BAD92208.1
act_site 391 - 391 1
act_site 989 - 989 2
binding 231 - 231 Chloride 1
binding 529 - 529 Chloride 1
binding 791 - 791 Chloride 2
binding 829 - 829 Chloride 3
binding 1090 - 1090 Chloride 2
binding 1094 - 1094 Chloride 2
binding 1127 - 1127 Chloride 3
carbohyd 38 - 38 N-linked (GlcNAc...) (Probable)
carbohyd 54 - 54 N-linked (GlcNAc...)
carbohyd 74 - 74 N-linked (GlcNAc...)
carbohyd 111 - 111 N-linked (GlcNAc...)
carbohyd 146 - 146 N-linked (GlcNAc...)
carbohyd 160 - 160 N-linked (GlcNAc...) (Potential)
carbohyd 318 - 318 N-linked (GlcNAc...)
carbohyd 445 - 445 N-linked (GlcNAc...)
carbohyd 509 - 509 N-linked (GlcNAc...)
carbohyd 677 - 677 N-linked (GlcNAc...) (Potential)
carbohyd 695 - 695 N-linked (GlcNAc...) (complex)
carbohyd 714 - 714 N-linked (GlcNAc...) (complex)
carbohyd 760 - 760 N-linked (GlcNAc...); partial
carbohyd 942 - 942 N-linked (GlcNAc...); partial
carbohyd 1191 - 1191 N-linked (GlcNAc...); partial
chain 30 - 1232 Angiotensin-converting enzyme, soluble form. /FTId=PRO_0000028531.
chain 30 - 1306 Angiotensin-converting enzyme /FTId=PRO_0000028530.
conflict 35 - 35 Q -> E (in Ref. 7; AA sequence)
conflict 42 - 42 D -> R (in Ref. 7; AA sequence)
metal 390 - 390 Zinc 1; catalytic
metal 394 - 394 Zinc 1; catalytic
metal 418 - 418 Zinc 1; catalytic
metal 988 - 988 Zinc 2; catalytic
metal 992 - 992 Zinc 2; catalytic
metal 1016 - 1016 Zinc 2; catalytic
Modification 716 - 716 Phosphothreonine
Modification 1299 - 1299 Phosphoserine
mutagen 1299 - 1299 S->A: Abolishes phosphorylation and decreases membrane retention.
propep 1233 - 1306 Removed in soluble form /FTId=PRO_0000028532.
region 30 - 630 Peptidase M2 1
region 631 - 1232 Peptidase M2 2
site 1225 - 1225 Not glycosylated
topo_dom 30 - 1256 Extracellular (Potential)
topo_dom 1278 - 1306 Cytoplasmic (Potential)
transmem 1257 - 1277 Helical; (Potential)
var_seq 1 - 574 Missing (in isoform Testis-specific) /FTId=VSP_035120.
var_seq 575 - 641 AGSSRPWQEVLKDMVGLDALDAQPLLKYFQPVTQWLQEQNQ QNGEVLGWPEYQWHPPLPDNYPEGID -> MGQGWATAGLP SLLFLLLCYGHPLLVPSQEASQQVTVTHGTSSQATTSSQTT THQATAHQTSAQSPN (in isoform Testis- specific). /FTId=VSP_035121.
var_seq 1137 - 1145 QFHEALCQA -> HPFSQHTAA (in isoform Somatic-2). /FTId=VSP_029932.
var_seq 1146 - 1306 Missing (in isoform Somatic-2) /FTId=VSP_029933.
variant 154 - 154 A -> T (in dbSNP:rs13306087) /FTId=VAR_029139.
variant 183 - 183 A -> T (in dbSNP:rs12720754) /FTId=VAR_029140.
variant 244 - 244 Y -> C (in dbSNP:rs3730025) /FTId=VAR_023430.
variant 260 - 260 R -> C (in dbSNP:rs4302) /FTId=VAR_054000.
variant 260 - 260 R -> L (in dbSNP:rs4303) /FTId=VAR_054001.
variant 261 - 261 A -> S (in dbSNP:rs4303) /FTId=VAR_011707.
variant 351 - 351 P -> L (in dbSNP:rs2229839) /FTId=VAR_023431.
variant 354 - 354 G -> R (in dbSNP:rs56394458) /FTId=VAR_035434.
variant 379 - 379 R -> Q (in dbSNP:rs13306085) /FTId=VAR_029141.
variant 524 - 524 V -> A (in dbSNP:rs12720746) /FTId=VAR_029142.
variant 561 - 561 R -> W (in dbSNP:rs4314) /FTId=VAR_011708.
variant 592 - 592 D -> G (in dbSNP:rs12709426) /FTId=VAR_020053.
variant 828 - 828 M -> T (in dbSNP:rs13306091) /FTId=VAR_034602.
variant 916 - 916 T -> M (in dbSNP:rs3730043) /FTId=VAR_023432.
variant 1018 - 1018 I -> T (in dbSNP:rs4976) /FTId=VAR_014189.
variant 1051 - 1051 F -> V (in dbSNP:rs4977) /FTId=VAR_014190.
variant 1187 - 1187 T -> M (in dbSNP:rs12709442) /FTId=VAR_023433.
variant 1228 - 1228 P -> L (no effect on activity; increases secretion; rate of solubilization is 2.5- fold higher than wild-type). /FTId=VAR_023434.
variant 1279 - 1279 R -> Q (in dbSNP:rs4980) /FTId=VAR_014191.
variant 1286 - 1286 R -> S (in dbSNP:rs4364) /FTId=VAR_011709.
variant 1296 - 1296 Q -> P (in dbSNP:rs4981) /FTId=VAR_014192.
keyword 1 - 1306 3D-structure
keyword 1 - 1306 Alternative splicing
keyword 1 - 1306 Carboxypeptidase
keyword 1 - 1306 Cell membrane
keyword 1 - 1306 Complete proteome
keyword 1 - 1306 Direct protein sequencing
keyword 1 - 1306 Disulfide bond
keyword 1 - 1306 Glycoprotein
keyword 1 - 1306 Hydrolase
keyword 1 - 1306 Membrane
keyword 1 - 1306 Metal-binding
keyword 1 - 1306 Metalloprotease
keyword 1 - 1306 Phosphoprotein
keyword 1 - 1306 Polymorphism
keyword 1 - 1306 Protease
keyword 1 - 1306 Repeat
keyword 1 - 1306 Secreted
keyword 1 - 1306 Signal
keyword 1 - 1306 Transmembrane
keyword 1 - 1306 Transmembrane helix
keyword 1 - 1306 Zinc
Molecular Weight 1 - 1306 149715
2 hits 1 - 1306 PF01401
2 hits 1 - 1306 PS00142

If you do not find the reagent or information you require, please contact customer.support@lsbio.com to inquire about additional products in development.

PLEASE NOTE

For RESEARCH USE ONLY. Not intended for human diagnostic or therapeutic purposes.

The data on this page has been compiled from LifeSpan internal sources, the National Center for Biotechnology Information (NCBI), and The Universal Protein Resource (UniProt).


Get Social With Us! Follow us on Facebook Follow us on Google+ Follow us on LinkedIn
Copyright © 2015 LifeSpan BioSciences, Inc. All Rights Reserved Privacy Policy