Menu
Products
Services
Research Areas
Resources
Contact Us
Distributors
Login
Quick Order
Cart
Login
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.


Fields marked with a * are required.

Login
Quick Order
Services
Immunohistochemistry Services

Work with LifeSpan to design a custom immunohistochemistry to address your specific biological question. Outsource the entire localization process without having to worry about finding and characterizing target specific antibodies, sourcing and validating difficult-to-find tissues, and having the ability to interpret the resulting immunostaining in relation to complex human pathologies.

TCR Screening Services

Test your therapeutic antibodies in immunohistochemistry against a broad panel of normal frozen human tissue types in order to determine potential unintended binding. Our non-GLP TCR services are designed on the FDA recommendation outlined in their "Points to Consider in the Manufacture and Testing of Monoclonal Antibody Products for Human Use".

Research Areas
Cell Cycle Pathways
Protein Family And Group
Infectious Disease
Contact Us
LSBio
2401 Fourth Avenue Suite 900
Seattle WA 98121
Phone:
866-819-4732 (Toll Free North America
206-374-1102 (International)
Fax:
866-206-6909 (Toll Free North America)
206-577-4565 (International)
How To Buy - Details about how to buy our products.
Orders@LSBio.com - To submit a new order.
Customer.Support@LSBio.com - To submit questions about existing orders, pricing, availability, bulk quotes, froforma invoice requests, or other billing issues.
Technical.Support@LSBio.com - To request technical information about an LSBio product or its applications
Sales@LSBio.com - To request information about fee-for-service contract IHC studies, IHC reports, distribution agreements, or general business development.
Worldwide Distributors List - To find your local distributor if you're not within the United States.
Login
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.


Fields marked with a * are required.

Login
Quick Order
Catalog Number Size Price
LS-G5753-5 5 µg $225 
LS-G5753-20 20 µg $315 
LS-G5753-100 100 µg $800 
LS-G5753-250 250 µg $1,680 
LS-G5753-500 500 µg $2,145 
LS-G5753-1 1 mg $3,180 
IL4 Protein

Rhesus monkey IL4 Protein (Recombinant) (aa25-153) - LS-G5753

Rhesus monkey IL4 Protein (Recombinant) (aa25-153) - LS-G5753

Description:
IL4 Protein LS-G5753 is Recombinant Rhesus monkey IL4 aa 25-153 produced in E. coli It is biologically active
Price
Catalog Number
$225 
LS-G5753-5
Toll Free North America
866-819-4732

Overview

Description:
IL4 Protein LS-G5753 is Recombinant Rhesus monkey IL4 aa 25-153 produced in E. coli It is biologically active

Specifications

Type
Recombinant Protein
Target
IL4
Synonyms
IL4 | B cell growth factor 1 | B-cell stimulatory factor 1 | B_cell stimulatory factor 1 | BCGF1 | BSF-1 | Binetrakin | BCGF-1 | Interleukin 4 | Interleukin-4 | Pitrakinra | BSF1 | IL-4
Species
Rhesus monkey
Modifications
Unmodified
Conjugations
Unconjugated
Predicted Molecular Weight
14.9 kDa
AA Sequence
HNCHIALREIIETLNSLTEQKTLCTKLTITDILAASKNTTEKETFCRAATVLRQFYSHHEKDTRCLGATAQQFHRHKQLIRFLKRLDRNLWGLAGLNSCPVKEANQSTLEDFLERLKTIMREKYSKCSS
Expression System
E. coli
Source Species
E. coli
Purification
Greater than 96% by SDS-PAGE and HPLC
Bio-Activity
Fully biologically active when compared to standard. The ED50 as determined by a cell proliferation assay using human TF-1 cells is less than 1.0 ng/ml, corresponding to a specific activity of > 1.0 x 106 IU/mg.
Endotoxin
Not Tested
Presentation
Tris, 50% Glycerol
Reconstitution
Reconstitute in sterile distilled water to 0.1-1 mg/ml.
Storage
Store lyophilized at -20°C. The reconstituted product can be stored for short term at 4°C or long term at -20°C or below. Avoid freeze/thaw cycles.
Restrictions
For research use only.
Guarantee
This protein carries the LSBio 100% Guarantee.
LSBio Guarantee
About IL4
P05112 NM_000589 NP_000580.1

Publications (0)

Customer Reviews (0)

Images

Sodium Dodecyl Sulfate - Polyacrylamide Gel Electrophoresis

IL4 Protein

Sodium Dodecyl Sulfate - Polyacrylamide Gel Electrophoresis

IL4 Protein

Sodium Dodecyl Sulfate - Polyacrylamide Gel Electrophoresis

IL4 Protein

Sodium Dodecyl Sulfate - Polyacrylamide Gel Electrophoresis

IL4 Protein

Requested From: United States
Date Requested: 2/26/2020